BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045643
         (179 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome
           P450 In Complex With Androstenedione
 pdb|3S79|A Chain A, Human Placental Aromatase Cytochrome P450 (Cyp19a1)
           Refined At 2.75 Angstrom
 pdb|3S7S|A Chain A, Crystal Structure Of Human Placental Aromatase Complexed
           With Breast Cancer Drug Exemestane
 pdb|4GL5|A Chain A, Structure Of Human Placental Aromatase Complexed With
           Designed Inhibitor Hddg029 (Compound 4)
 pdb|4GL7|A Chain A, Structure Of Human Placental Aromatase Complexed With
           Designed Inhibitor Hddg046 (Compound 5)
          Length = 503

 Score = 26.6 bits (57), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 126 LPNFVVSVLMLYYNFTGFGCSGILGQCFN-VVFNASLLTLFVNFH 169
           L NF  +V   Y+   GFG  G  G+    V+  A L+TL   FH
Sbjct: 415 LENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFH 459


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.333    0.145    0.469 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,011,271
Number of Sequences: 62578
Number of extensions: 129327
Number of successful extensions: 275
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 275
Number of HSP's gapped (non-prelim): 2
length of query: 179
length of database: 14,973,337
effective HSP length: 93
effective length of query: 86
effective length of database: 9,153,583
effective search space: 787208138
effective search space used: 787208138
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 48 (23.1 bits)