Query         045647
Match_columns 218
No_of_seqs    178 out of 992
Neff          6.7 
Searched_HMMs 46136
Date          Fri Mar 29 04:02:33 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045647.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045647hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0   9E-45 1.9E-49  285.2   7.0  127    8-141     1-129 (129)
  2 smart00265 BH4 BH4 Bcl-2 homol  36.3      37 0.00081   19.5   2.1   20   17-36      4-23  (27)
  3 PHA00692 hypothetical protein   35.9      15 0.00033   25.1   0.5    9    7-15     36-44  (74)
  4 PF11285 DUF3086:  Protein of u  35.5     9.8 0.00021   33.5  -0.6   26   46-73    128-153 (283)
  5 PF07960 CBP4:  CBP4;  InterPro  29.5      29 0.00063   27.4   1.2   12   14-25     29-40  (128)
  6 PRK02079 pyrroloquinoline quin  28.2      34 0.00075   25.0   1.3   15    1-15      1-15  (88)
  7 PF01473 CW_binding_1:  Putativ  26.2      48   0.001   16.8   1.3    8   68-75      7-14  (19)
  8 COG4472 Uncharacterized protei  24.3      48   0.001   24.1   1.4   11   19-29     74-84  (88)
  9 PF06214 SLAM:  Signaling lymph  23.3      21 0.00045   27.7  -0.6   48   27-76     75-122 (126)
 10 PF13822 ACC_epsilon:  Acyl-CoA  23.0      44 0.00095   22.7   1.0    9   15-23     10-18  (62)
 11 PLN02417 dihydrodipicolinate s  22.3      63  0.0014   28.3   2.1   19    7-26    102-120 (280)
 12 smart00707 RPEL Repeat in Dros  22.0      64  0.0014   18.4   1.4   13   11-23      6-18  (26)
 13 cd00490 Met_repressor_MetJ Met  21.8      97  0.0021   23.0   2.6   39   15-60     50-88  (103)
 14 PF04700 Baculo_gp41:  Structur  21.1      99  0.0021   25.9   2.8   20   17-36      6-27  (186)
 15 cd00954 NAL N-Acetylneuraminic  20.1      74  0.0016   27.8   2.1   18    8-26    103-120 (288)
 16 PRK05264 transcriptional repre  20.0 1.1E+02  0.0023   22.9   2.6   39   15-60     51-89  (105)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=9e-45  Score=285.20  Aligned_cols=127  Identities=38%  Similarity=0.727  Sum_probs=92.5

Q ss_pred             CCCCCccCCCHHHHHHHHHhhhhcCCCCCCCCCcccccCCCCCCCCCchhhhcccccCCCCceEEEEEecccccCCCCcc
Q 045647            8 LPLGCKFQPSDEQLVLFYLFNKISGTPAPFLDDFVRTENLYGNKEPWQIWRQFGVRDLEDGEDLYFFTRLKKKSVNGSRI   87 (218)
Q Consensus         8 LppGfRF~PTDeELV~~YL~~Ki~g~~~p~~~~ii~~~DvY~~~~Pw~L~~~~~~~~~~~~~~wyFFs~~~kk~~~g~R~   87 (218)
                      |||||||+|||+|||.+||++|+.|.+++.. .+|+++|||+ +|||+|+...    ..++++||||+++++++.++.|.
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~-~~i~~~Diy~-~~P~~L~~~~----~~~~~~~yFF~~~~~~~~~~~r~   74 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCE-DVIHDVDIYS-AHPWELPAKF----KGGDEEWYFFSPRKKKYPNGGRP   74 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS--CHSEE--GGG-S-GGGCHHHS----SS-SSEEEEEEE----------S
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcc-cceeecccCc-cChHHhhhhc----cCCCceEEEEEecccccCCcccc
Confidence            8999999999999999999999999998875 4677779999 8999999532    23567999999999999999999


Q ss_pred             cccccCceeeecCCCceEEeCCCCeEEeeEEeEeeecCCCC--CCcCeEEEEEEeC
Q 045647           88 DRRVGTGTWQGEDAGKAVVSRNSRKKIGSKKRFRYEKDQSP--HNCCWILHEYSLN  141 (218)
Q Consensus        88 ~R~~~~G~Wk~~g~~k~I~~~~~g~~vG~kktl~f~~g~~~--~~T~WvM~EY~l~  141 (218)
                      +|++++|+||++|+.+.|.+. ++++||+|++|+||.++.+  .+|+|+||||+|.
T Consensus        75 ~R~~~~G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   75 NRVTGGGYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             -EEETTEEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             cccccceEEeecccccccccc-cceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            999999999999999999875 8899999999999976554  4899999999984


No 2  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=36.27  E-value=37  Score=19.53  Aligned_cols=20  Identities=25%  Similarity=0.316  Sum_probs=16.0

Q ss_pred             CHHHHHHHHHhhhhcCCCCC
Q 045647           17 SDEQLVLFYLFNKISGTPAP   36 (218)
Q Consensus        17 TDeELV~~YL~~Ki~g~~~p   36 (218)
                      +-.|||.+|+.-|+.-+-.+
T Consensus         4 ~nRelV~~yv~yKLsQrgy~   23 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCC
Confidence            45799999999999876443


No 3  
>PHA00692 hypothetical protein
Probab=35.90  E-value=15  Score=25.11  Aligned_cols=9  Identities=33%  Similarity=0.715  Sum_probs=7.3

Q ss_pred             CCCCCCccC
Q 045647            7 PLPLGCKFQ   15 (218)
Q Consensus         7 ~LppGfRF~   15 (218)
                      ..||||||-
T Consensus        36 eyppgfrfg   44 (74)
T PHA00692         36 EYPPGFRFG   44 (74)
T ss_pred             ecCCCcccc
Confidence            579999995


No 4  
>PF11285 DUF3086:  Protein of unknown function (DUF3086);  InterPro: IPR021437  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=35.47  E-value=9.8  Score=33.55  Aligned_cols=26  Identities=42%  Similarity=0.864  Sum_probs=18.6

Q ss_pred             CCCCCCCCCchhhhcccccCCCCceEEE
Q 045647           46 NLYGNKEPWQIWRQFGVRDLEDGEDLYF   73 (218)
Q Consensus        46 DvY~~~~Pw~L~~~~~~~~~~~~~~wyF   73 (218)
                      |.|+  +||.|-..+.+.+...=+.|||
T Consensus       128 DyYg--~PWqLRRtfe~~hae~v~~WFF  153 (283)
T PF11285_consen  128 DYYG--PPWQLRRTFEPIHAERVEDWFF  153 (283)
T ss_pred             CccC--ChHHHHhcccHHHHHHHHHHHh
Confidence            7887  8999987776654433456876


No 5  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=29.51  E-value=29  Score=27.40  Aligned_cols=12  Identities=33%  Similarity=0.598  Sum_probs=10.1

Q ss_pred             cCCCHHHHHHHH
Q 045647           14 FQPSDEQLVLFY   25 (218)
Q Consensus        14 F~PTDeELV~~Y   25 (218)
                      -.||||||+..|
T Consensus        29 ~tPTeEeL~~r~   40 (128)
T PF07960_consen   29 TTPTEEELFKRY   40 (128)
T ss_pred             cCCCHHHHHHhc
Confidence            379999999875


No 6  
>PRK02079 pyrroloquinoline quinone biosynthesis protein PqqD; Provisional
Probab=28.18  E-value=34  Score=25.00  Aligned_cols=15  Identities=33%  Similarity=0.532  Sum_probs=12.2

Q ss_pred             CCCCCCCCCCCCccC
Q 045647            1 MQGTRPPLPLGCKFQ   15 (218)
Q Consensus         1 m~~~~~~LppGfRF~   15 (218)
                      |-+..+.|++||||+
T Consensus         1 ~~~~~p~l~~~~rl~   15 (88)
T PRK02079          1 DRNQVPTLRPGYRFQ   15 (88)
T ss_pred             CCCCCcccCCCcccc
Confidence            446678999999987


No 7  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=26.18  E-value=48  Score=16.83  Aligned_cols=8  Identities=25%  Similarity=0.875  Sum_probs=6.3

Q ss_pred             CceEEEEE
Q 045647           68 GEDLYFFT   75 (218)
Q Consensus        68 ~~~wyFFs   75 (218)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            57899994


No 8  
>COG4472 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.33  E-value=48  Score=24.14  Aligned_cols=11  Identities=45%  Similarity=0.769  Sum_probs=9.3

Q ss_pred             HHHHHHHHhhh
Q 045647           19 EQLVLFYLFNK   29 (218)
Q Consensus        19 eELV~~YL~~K   29 (218)
                      ||||.+||+.+
T Consensus        74 EElvk~YLk~~   84 (88)
T COG4472          74 EELVKYYLKGN   84 (88)
T ss_pred             HHHHHHHHhhc
Confidence            79999999754


No 9  
>PF06214 SLAM:  Signaling lymphocytic activation molecule (SLAM) protein;  InterPro: IPR010407 This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70 kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones []. SLAM has also been recognised as a receptor for Measles virus [].; GO: 0004872 receptor activity, 0046649 lymphocyte activation, 0009986 cell surface, 0016021 integral to membrane; PDB: 3ALX_D 3ALZ_B 3ALW_A.
Probab=23.26  E-value=21  Score=27.68  Aligned_cols=48  Identities=17%  Similarity=0.000  Sum_probs=24.5

Q ss_pred             hhhhcCCCCCCCCCcccccCCCCCCCCCchhhhcccccCCCCceEEEEEe
Q 045647           27 FNKISGTPAPFLDDFVRTENLYGNKEPWQIWRQFGVRDLEDGEDLYFFTR   76 (218)
Q Consensus        27 ~~Ki~g~~~p~~~~ii~~~DvY~~~~Pw~L~~~~~~~~~~~~~~wyFFs~   76 (218)
                      ++||..-+++.....-..-|=|. +++.+|--.--. .+..++.|||.+-
T Consensus        75 kkKIvSldl~eg~sp~yledgY~-FhlEnLsL~Il~-SrkE~EGWYfmtl  122 (126)
T PF06214_consen   75 KKKIVSLDLSEGGSPRYLEDGYK-FHLENLSLEILE-SRKEDEGWYFMTL  122 (126)
T ss_dssp             -EEEEEE-TTS-SS-EESSSSEE-EETTTTEEEETT---GGG-EEEEEEE
T ss_pred             hheEEEeccccCCCccccccccE-Eecccceeehhc-cccccCceEEEEe
Confidence            46666655554332222337888 899988432111 1234567999875


No 10 
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=23.03  E-value=44  Score=22.74  Aligned_cols=9  Identities=44%  Similarity=0.840  Sum_probs=7.5

Q ss_pred             CCCHHHHHH
Q 045647           15 QPSDEQLVL   23 (218)
Q Consensus        15 ~PTDeELV~   23 (218)
                      +||||||--
T Consensus        10 nPt~eElAA   18 (62)
T PF13822_consen   10 NPTDEELAA   18 (62)
T ss_pred             CCCHHHHHH
Confidence            799999854


No 11 
>PLN02417 dihydrodipicolinate synthase
Probab=22.31  E-value=63  Score=28.27  Aligned_cols=19  Identities=16%  Similarity=0.093  Sum_probs=14.9

Q ss_pred             CCCCCCccCCCHHHHHHHHH
Q 045647            7 PLPLGCKFQPSDEQLVLFYL   26 (218)
Q Consensus         7 ~LppGfRF~PTDeELV~~YL   26 (218)
                      -+|| |.|.||++||+.||-
T Consensus       102 ~~~P-~y~~~~~~~i~~~f~  120 (280)
T PLN02417        102 HINP-YYGKTSQEGLIKHFE  120 (280)
T ss_pred             EcCC-ccCCCCHHHHHHHHH
Confidence            3566 568999999999873


No 12 
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=21.99  E-value=64  Score=18.36  Aligned_cols=13  Identities=23%  Similarity=0.253  Sum_probs=10.9

Q ss_pred             CCccCCCHHHHHH
Q 045647           11 GCKFQPSDEQLVL   23 (218)
Q Consensus        11 GfRF~PTDeELV~   23 (218)
                      ...++||-+|||.
T Consensus         6 kl~~RP~~eeLv~   18 (26)
T smart00707        6 KLSQRPTREELEE   18 (26)
T ss_pred             HHHcCCCHHHHHH
Confidence            4568999999997


No 13 
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=21.81  E-value=97  Score=22.98  Aligned_cols=39  Identities=15%  Similarity=0.199  Sum_probs=28.2

Q ss_pred             CCCHHHHHHHHHhhhhcCCCCCCCCCcccccCCCCCCCCCchhhhc
Q 045647           15 QPSDEQLVLFYLFNKISGTPAPFLDDFVRTENLYGNKEPWQIWRQF   60 (218)
Q Consensus        15 ~PTDeELV~~YL~~Ki~g~~~p~~~~ii~~~DvY~~~~Pw~L~~~~   60 (218)
                      |-|..||+..-...-..|+|||...      |+-+ ..|.++|+..
T Consensus        50 HATNSELLCEAFLHAfTGQPLP~D~------Dl~K-~~~d~iP~~a   88 (103)
T cd00490          50 HATNSELLCEAFLHAFTGQPLPDDA------DLRK-ERSDEIPEAA   88 (103)
T ss_pred             hcccHHHHHHHHHHHhcCCCCCChh------hhhh-cCcccccHHH
Confidence            4566777776566778999999742      7766 6788888753


No 14 
>PF04700 Baculo_gp41:  Structural glycoprotein p40/gp41 conserved region;  InterPro: IPR006790 This is a family of viral structural glycoproteins [] from the baculoviridae.; GO: 0005198 structural molecule activity, 0019012 virion
Probab=21.05  E-value=99  Score=25.91  Aligned_cols=20  Identities=45%  Similarity=0.805  Sum_probs=14.3

Q ss_pred             CHHHHHHHH--HhhhhcCCCCC
Q 045647           17 SDEQLVLFY--LFNKISGTPAP   36 (218)
Q Consensus        17 TDeELV~~Y--L~~Ki~g~~~p   36 (218)
                      +|||||.||  |.++..|...+
T Consensus         6 sDe~Li~yY~~L~K~~g~~~~~   27 (186)
T PF04700_consen    6 SDEELIEYYANLEKKYGGSDVP   27 (186)
T ss_pred             cHHHHHHHHHHHHHHhCCCCCC
Confidence            799999999  55555555443


No 15 
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=20.07  E-value=74  Score=27.85  Aligned_cols=18  Identities=17%  Similarity=0.130  Sum_probs=13.7

Q ss_pred             CCCCCccCCCHHHHHHHHH
Q 045647            8 LPLGCKFQPSDEQLVLFYL   26 (218)
Q Consensus         8 LppGfRF~PTDeELV~~YL   26 (218)
                      +||- .|.||++||+.||.
T Consensus       103 ~~P~-y~~~~~~~i~~~~~  120 (288)
T cd00954         103 ITPF-YYKFSFEEIKDYYR  120 (288)
T ss_pred             eCCC-CCCCCHHHHHHHHH
Confidence            4554 48899999999863


No 16 
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=20.01  E-value=1.1e+02  Score=22.87  Aligned_cols=39  Identities=15%  Similarity=0.225  Sum_probs=28.1

Q ss_pred             CCCHHHHHHHHHhhhhcCCCCCCCCCcccccCCCCCCCCCchhhhc
Q 045647           15 QPSDEQLVLFYLFNKISGTPAPFLDDFVRTENLYGNKEPWQIWRQF   60 (218)
Q Consensus        15 ~PTDeELV~~YL~~Ki~g~~~p~~~~ii~~~DvY~~~~Pw~L~~~~   60 (218)
                      |-|..||+..-...-..|+|||...      |+-+ ..|.++|+..
T Consensus        51 HATNSELLCEAFLHA~TGQPLP~D~------Dl~K-d~~d~ip~~a   89 (105)
T PRK05264         51 HATNSELLCEAFLHAFTGQPLPDDE------DLRK-ERSDEIPEAA   89 (105)
T ss_pred             hcccHHHHHHHHHHHHcCCCCCChh------hhhh-cCcccchHHH
Confidence            4566777776566778999999742      7766 6788888653


Done!