BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045701
         (653 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3B46|A Chain A, Crystal Structure Of Bna3p, A Putative Kynurenine
           Aminotransferase From Saccharomyces Cerevisiae
 pdb|3B46|B Chain B, Crystal Structure Of Bna3p, A Putative Kynurenine
           Aminotransferase From Saccharomyces Cerevisiae
          Length = 447

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 254 WEWMRGEFIYTMKGAYTRNIDYSGCLY-GPAGTYYADMDFSKVMNCEKRP 302
           +E MR E+I   K  +T   D  G  Y  P GTY+  +DFSKV   E  P
Sbjct: 329 FEKMRQEYINKFK-IFTSIFDELGLPYTAPEGTYFVLVDFSKVKIPEDYP 377


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.425 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,902,102
Number of Sequences: 62578
Number of extensions: 857828
Number of successful extensions: 1556
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1556
Number of HSP's gapped (non-prelim): 7
length of query: 653
length of database: 14,973,337
effective HSP length: 105
effective length of query: 548
effective length of database: 8,402,647
effective search space: 4604650556
effective search space used: 4604650556
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)