Citrus Sinensis ID: 045707


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-
MEDVKKRKMEDDNILINGQDFNSSSSSSQDHLRSLLDPLSKSQLVDLLSRLGSQYPSIAEEIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFITYKHMESTQSALRAPSKLIDGRLAVCNLACEGLSGVSAVPDLAQRKLYIGGLSPEVTTEVLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVEAAKKAVDDPHKTLGGRTIIVKLADTHKGKPPQTQLPAAVVPVPLPLGAGYPQAGKAHANTPPVGYSYPQNVPPYPTSSYTSPNTAPVPYPTQPPISYPPIPLKKDPIGPIGHPATAPKRRIASILGRVSSNFVENPKKSLKIAFLPTGSFYFAQTPRLFSKSLPFSNENVSKSPFVRKEAQAAMLEYLHLTRNLPFMDAEHMSKNSPHFVEKLIERFENQLDVQRLIARFLRYHPINEFEPFFESLGLKPCEYSPFLPLNLMFLSDDELLLENYHVLCNYGVARNKIGKILKEAREVFQFDVGVFQSKLHAYEMLGLSQSFISKVIVCSPYLLIGDVNTEFVEVLQILKSMEIESCWIEEHLLEQETFNWSMMLRFLRLFRNLGCSDEQLGGLIRQHPGLLFEGSGSIALTMIGLLLKFGSTRNELCSIFLQFPQIEVRKFLLNLNQCLLFLFEIKMKVDEIGKILRCHFLLVGSCTLKKTNTILAYLNVGKKRLCEYIQENPLELKKLALGSRVGRLPAEKERSQLLRTKFLLDVGYVENSNEMAKALKHFRGRGAELQERFDCLVNAGLDRKDVCEMIRVSPQILNMKKDVIKSKIDFLVNYLGYPLSFLVSFPSYFNYTEERIKLRFLMYNWLKDEGWIDGRLASSTLIAYSNKTFMQQFVNRHPKGPEVWQTFKKQIYSEE
cccHHHccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHcccccccHHHHccccccccccccEEEccccccccHHHHHHHHHccccEEEEEEEEccccccccccEEEEEccHHHHHHHHcccccEEccEEEEEccccccccccccccccccccEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEEccHHHHHHHHccccCEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHccccccccccccccccCEEEcccHHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHEEEEEccEEECccccHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHcccccccccEEECcccHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccEEEEccccccHHHHHHHHcccHHHHHHHHHHccHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHccc
*********************************************DL**********************PVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFITYKHMESTQSALRAPSKLIDGRLAVCNLACE*********DLAQRKLYIGGLSPEVTTEVLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVEAAKKAVDDPHKTLGGRTIIVKLAD**************VVPVPLPLG*************************************************************************IASILGRVSSNFVENPKKSLKIAFLPTGSFYFAQTPRLFSKS****************EAQAAMLEYLHLTRNLPFMDAEHMSKNSPHFVEKLIERFENQLDVQRLIARFLRYHPINEFEPFFESLGLKPCEYSPFLPLNLMFLSDDELLLENYHVLCNYGVARNKIGKILKEAREVFQFDVGVFQSKLHAYEMLGLSQSFISKVIVCSPYLLIGDVNTEFVEVLQILKSMEIESCWIEEHLLEQETFNWSMMLRFLRLFRNLGCSDEQLGGLIRQHPGLLFEGSGSIALTMIGLLLKFGSTRNELCSIFLQFPQIEVRKFLLNLNQCLLFLFEIKMKVDEIGKILRCHFLLVGSCTLKKTNTILAYLNVGKKRLCEYIQENPLELKKLALGSRVGRL******SQLLRTKFLLDVGYVENSNEMAKALKHFRGRGAELQERFDCLVNAGLDRKDVCEMIRVSPQILNMKKDVIKSKIDFLVNYLGYPLSFLVSFPSYFNYTEERIKLRFLMYNWLKDEGWIDGRLASSTLIAYSNKTFMQQFVNRHPKGPEVWQTFKKQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDVKKRKMEDDNILINGQDFNSSSSSSQDHLRSLLDPLSKSQLVDLLSRLGSQYPSIAEEIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFITYKHMESTQSALRAPSKLIDGRLAVCNLACEGLSGVSAVPDLAQRKLYIGGLSPEVTTEVLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVEAAKKAVDDPHKTLGGRTIIVKLADTHKGKPPQTQLPAAVVPVPLPLGAGYPQAGKAHANTPPVGYSYPQNVPPYPTSSYTSPNTAPVPYPTQPPISYPPIPLKKDPIGPIGHPATAPKRRIASILGRVSSNFVENPKKSLKIAFLPTGSFYFAQTPRLFSKSLPFSNENVSKSPFVRKEAQAAMLEYLHLTRNLPFMDAEHMSKNSPHFVEKLIERFENQLDVQRLIARFLRYHPINEFEPFFESLGLKPCEYSPFLPLNLMFLSDDELLLENYHVLCNYGVARNKIGKILKEAREVFQFDVGVFQSKLHAYEMLGLSQSFISKVIVCSPYLLIGDVNTEFVEVLQILKSMEIESCWIEEHLLEQETFNWSMMLRFLRLFRNLGCSDEQLGGLIRQHPGLLFEGSGSIALTMIGLLLKFGSTRNELCSIFLQFPQIEVRKFLLNLNQCLLFLFEIKMKVDEIGKILRCHFLLVGSCTLKKTNTILAYLNVGKKRLCEYIQENPLELKKLALGSRVGRLPAEKERSQLLRTKFLLDVGYVENSNEMAKALKHFRGRGAELQERFDCLVNAGLDRKDVCEMIRVSPQILNMKKDVIKSKIDFLVNYLGYPLSFLVSFPSYFNYTEERIKLRFLMYNWLKDEGWIDGRLASSTLIAYSNKTFMQQFVNRHPKGPEVWQTFKKQIYSEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMR, chain A
Confidence level:very confident
Coverage over the Query: 71-240
View the alignment between query and template
View the model in PyMOL
Template: 3NMR, chain A
Confidence level:very confident
Coverage over the Query: 26-148
View the alignment between query and template
View the model in PyMOL
Template: 3MVA, chain O
Confidence level:very confident
Coverage over the Query: 487-560,593-724,738,772-881
View the alignment between query and template
View the model in PyMOL
Template: 3M66, chain A
Confidence level:very confident
Coverage over the Query: 522-560,593-693,773-895
View the alignment between query and template
View the model in PyMOL
Template: 3MVA, chain O
Confidence level:very confident
Coverage over the Query: 454-560,593-725,772-848
View the alignment between query and template
View the model in PyMOL
Template: 4FZV, chain B
Confidence level:confident
Coverage over the Query: 696-724,738-890
View the alignment between query and template
View the model in PyMOL
Template: 4FZV, chain B
Confidence level:probable
Coverage over the Query: 531-673
View the alignment between query and template
View the model in PyMOL