BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045724
         (168 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC
           204508 / S288c) GN=PUT4 PE=1 SV=2
          Length = 627

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 24  LSRGGLLYDKDIATGLGAGSFLFLLISQIVIMAASRCLCCGRAMRPSGAR-VWAIVLF 80
           L+ G L    DI TG+  G+F F+L  ++V M ++ C    R +  +  R VW ++ F
Sbjct: 301 LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFF 358


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.331    0.144    0.438 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,502,963
Number of Sequences: 539616
Number of extensions: 2126949
Number of successful extensions: 5162
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 5156
Number of HSP's gapped (non-prelim): 8
length of query: 168
length of database: 191,569,459
effective HSP length: 109
effective length of query: 59
effective length of database: 132,751,315
effective search space: 7832327585
effective search space used: 7832327585
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 57 (26.6 bits)