Citrus Sinensis ID: 045731

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----

MGKPSRSTILGFVFIFYTMICLLLLRNCYSSIIGSTKIDGIKVNSKQVNACLGRYIYIHDLPKQFNEDVLENCQLITRKIDKYDTCMYTLNSGFGPRIENSNGILSNSTSWFITDHFFLEVIFHNRMKNYECLTNDSSLASAIYVPFYAGLDLRRHLWGFKPSVRDSSGKNLIKWLLEKPEWEKMRGLDHFLVSGRPSLDFRRQSNSKWGSMFRILPESQNMTMLSVDSQSWSNDLAIPYPTYFHPSKQTEVSEWQERMRRLKREYLFCFVGATRNYGGSIRGSIIGQCKDSSSCKLLDCGDKTTNCYNPVNVMKAFESSVFCLQPPGDTPTRRSTFDSILAGCIPVFFHPGSAYTQYKWHLPKNHTKYSVFIPEKKLRDRRFRINETLLGVSKVEEEAMREEVIRLIPRTVYGDHKSKLEDAFDLAVKGVLERVEKLRGAINL

cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccccccHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHccHHHHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEEccccccccccHHcHHHHHHccccccccccccccccccccHHHHHHHHccCEECccccccccccHHHHHHHcccCEEEEcccccccccccccccccccEEEEECccccccccccHHHHHccccHHHHHHHHHHHHHHcccEEECcccccccHHHHHHHHHHHHHHHHHHHcccc

****SRSTILGFVFIFYTMICLLLLRNCYSSIIGSTK*********QVNACLGRYIYIHDLPKQFNEDVLENCQLITRKIDKYDTCMYTLNSGFGPRIENSNGILSNSTSWFITDHFFLEVIFHNRMKNYECLTNDSSLASAIYVPFYAGLDLRRHLWGFKPSVRDSSGKNLIKWLLEKPEWEKMRGLDHFLVSGRPSLDFRRQSNSKWGSMFRILPESQNMTMLSVDSQSWSNDLAIPYPTYFHPSKQTEVSEWQERMRRLKREYLFCFVGATRNYGGSIRGSIIGQCKDSSSCKLLDCGDKTTNCYNPVNVMKAFESSVFCLQPPGDTPTRRSTFDSILAGCIPVFFHPGSAYTQYKWHLPKNHTKYSVFIPEKKLRDRRFRINETLLGVSKVEEEAMREEVIRLIPRTVYGDHKSKLEDAFDLAVKGVLERVEKL******

xxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Xyloglucan galactosyltransferase KATAMARI1 homolog	Involved in the attachment of the Gal residue on the third xylosyl unit within the XXXG core structure of xyloglucan, the principal glycan that interlaces the cellulose microfibrils in plant cell wall. Interacts with actin and is required for the proper endomembrane organization and for the cell elongation.	probable	Q8H038

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QHP, chain A
Confidence level:probable
Coverage over the Query: 264-412
View the alignment between query and template
View the model in PyMOL

Template: 2O6L, chain A
Confidence level:probable
Coverage over the Query: 253-408
View the alignment between query and template
View the model in PyMOL