Query         045775
Match_columns 87
No_of_seqs    112 out of 137
Neff          2.7 
Searched_HMMs 46136
Date          Fri Mar 29 05:24:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045775.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045775hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0046 Ca2+-binding actin-bun  99.9 1.4E-25   3E-30  189.5   4.3   48    1-48    573-620 (627)
  2 COG5069 SAC6 Ca2+-binding acti  98.8 9.8E-10 2.1E-14   93.7   1.5   41    1-41    567-611 (612)
  3 smart00033 CH Calponin homolog  98.0   6E-06 1.3E-10   50.9   2.7   41    1-42     62-103 (103)
  4 PF00307 CH:  Calponin homology  97.7 1.9E-05   4E-10   49.2   2.0   42    2-43     64-107 (108)
  5 cd00014 CH Calponin homology d  97.4 8.9E-05 1.9E-09   46.3   2.0   42    1-42     62-105 (107)
  6 KOG0046 Ca2+-binding actin-bun  95.1   0.012 2.7E-07   51.3   2.1   40    3-42    325-364 (627)
  7 COG3480 SdrC Predicted secrete  63.9     3.4 7.4E-05   34.3   1.0   17    8-24    283-299 (342)
  8 PF00381 PTS-HPr:  PTS HPr comp  60.6     8.2 0.00018   24.2   2.1   39    3-46     19-57  (84)
  9 PF11761 CbiG_mid:  Cobalamin b  55.2     8.1 0.00017   23.6   1.4   19    8-27      6-24  (93)
 10 TIGR02899 spore_safA spore coa  53.1     7.2 0.00016   20.2   0.8   20    7-30      8-27  (44)
 11 PF00582 Usp:  Universal stress  51.9      13 0.00028   22.1   1.9   18    3-20     19-36  (140)
 12 PF00107 ADH_zinc_N:  Zinc-bind  50.3      13 0.00028   23.3   1.8   16    5-20      5-20  (130)
 13 PF01476 LysM:  LysM domain;  I  47.8      11 0.00023   20.3   1.0   21    7-31     10-30  (44)
 14 PF00488 MutS_V:  MutS domain V  47.6      11 0.00023   28.1   1.3   20    3-27    205-224 (235)
 15 cd03285 ABC_MSH2_euk MutS2 hom  45.5      14 0.00031   27.0   1.6   21    2-27    193-213 (222)
 16 PRK15118 universal stress glob  44.0      18 0.00039   23.3   1.8   17    4-20     21-37  (144)
 17 PRK10116 universal stress prot  41.7      21 0.00045   22.8   1.8   17    4-20     21-37  (142)
 18 COG1920 Predicted nucleotidylt  41.5      19 0.00041   28.3   1.8   22    7-28    149-181 (210)
 19 PRK15005 universal stress prot  40.9      19 0.00042   22.9   1.5   17    4-20     22-38  (144)
 20 cd01988 Na_H_Antiporter_C The   40.6      19 0.00042   22.1   1.5   18    4-21     17-34  (132)
 21 PRK09982 universal stress prot  40.3      21 0.00047   23.4   1.7   18    4-21     21-38  (142)
 22 KOG0806 Carbon-nitrogen hydrol  39.3      14  0.0003   30.0   0.8   23    3-25     35-57  (298)
 23 PRK13781 paaB phenylacetate-Co  38.2      26 0.00056   24.4   1.9   35    2-36     31-72  (95)
 24 TIGR02157 PA_CoA_Oxy2 phenylac  38.1      26 0.00057   24.1   1.9   35    2-36     26-67  (90)
 25 cd08294 leukotriene_B4_DH_like  35.4      28  0.0006   24.9   1.8   17    4-20    158-174 (329)
 26 PF03686 UPF0146:  Uncharacteri  35.2      28 0.00061   25.1   1.8   18    4-21     85-102 (127)
 27 PRK04148 hypothetical protein;  32.9      29 0.00063   24.7   1.5   18    4-21     92-109 (134)
 28 COG1255 Uncharacterized protei  31.3      32 0.00069   25.3   1.5   18    4-21     85-102 (129)
 29 TIGR00330 glpX fructose-1,6-bi  31.0      34 0.00074   28.3   1.8   21    5-25    168-189 (321)
 30 TIGR02825 B4_12hDH leukotriene  30.6      34 0.00074   24.9   1.6   17    4-20    153-169 (325)
 31 PF07085 DRTGG:  DRTGG domain;   29.5      51  0.0011   21.0   2.1   24    4-27     75-98  (105)
 32 PF06821 Ser_hydrolase:  Serine  29.0      41  0.0009   23.8   1.8   19    4-22    131-149 (171)
 33 PRK11175 universal stress prot  29.0      36 0.00078   24.6   1.5   17    4-20     21-37  (305)
 34 cd08274 MDR9 Medium chain dehy  28.9      37  0.0008   24.6   1.6   18    4-21    192-209 (350)
 35 PF00682 HMGL-like:  HMGL-like   28.9      95  0.0021   22.1   3.6   40    3-42    110-149 (237)
 36 TIGR02817 adh_fam_1 zinc-bindi  28.8      40 0.00086   24.3   1.7   17    4-20    163-180 (336)
 37 TIGR01003 PTS_HPr_family Phosp  28.6      52  0.0011   20.8   2.0   40    3-47     19-58  (82)
 38 PRK12388 fructose-1,6-bisphosp  28.5      40 0.00087   27.9   1.8   21    5-25    168-189 (321)
 39 PF08673 RsbU_N:  Phosphoserine  28.2      31 0.00067   22.5   0.9   20   19-38     35-54  (77)
 40 cd08295 double_bond_reductase_  28.0      43 0.00092   24.6   1.8   17    4-20    166-182 (338)
 41 TIGR01069 mutS2 MutS2 family p  27.8      33 0.00072   30.3   1.3   26    3-33    482-507 (771)
 42 cd08292 ETR_like_2 2-enoyl thi  27.7      44 0.00095   23.7   1.7   18    4-21    154-171 (324)
 43 PF03465 eRF1_3:  eRF1 domain 3  27.4      51  0.0011   22.2   1.9   22    4-25     72-93  (113)
 44 cd08269 Zn_ADH9 Alcohol dehydr  27.3      38 0.00083   23.8   1.4   20    3-22    142-162 (312)
 45 cd07944 DRE_TIM_HOA_like 4-hyd  26.7      58  0.0013   24.7   2.3   41    2-42    110-150 (266)
 46 PRK13782 phosphocarrier protei  26.6      60  0.0013   20.5   2.0   39    4-47     20-58  (82)
 47 cd01989 STK_N The N-terminal d  26.4      35 0.00076   21.8   1.0   17    4-20     17-33  (146)
 48 cd08288 MDR_yhdh Yhdh putative  25.6      50  0.0011   23.5   1.7   17    4-20    161-177 (324)
 49 cd01987 USP_OKCHK USP domain i  25.2      51  0.0011   20.4   1.5   17    4-20     17-33  (124)
 50 cd08291 ETR_like_1 2-enoyl thi  25.2      52  0.0011   23.9   1.7   17    4-20    158-174 (324)
 51 PRK00409 recombination and DNA  24.9      40 0.00087   29.8   1.3   25    3-32    487-511 (782)
 52 cd08244 MDR_enoyl_red Possible  24.7      55  0.0012   23.2   1.8   18    4-21    157-174 (324)
 53 PF02348 CTP_transf_3:  Cytidyl  24.7      74  0.0016   21.9   2.4   31    6-36     52-82  (217)
 54 cd01516 FBPase_glpX Bacterial   24.5      53  0.0011   27.0   1.8   20    5-24    168-188 (309)
 55 COG1064 AdhP Zn-dependent alco  24.5      50  0.0011   27.0   1.7   11   10-20    206-216 (339)
 56 cd07939 DRE_TIM_NifV Streptomy  24.3      80  0.0017   23.4   2.6   42    2-43    111-152 (259)
 57 cd05286 QOR2 Quinone oxidoredu  24.2      55  0.0012   22.4   1.6   17    4-20    151-167 (320)
 58 cd07574 nitrilase_Rim1_like Un  24.2      41  0.0009   24.3   1.1   21    4-24     24-44  (280)
 59 PF08032 SpoU_sub_bind:  RNA 2'  23.9      74  0.0016   18.7   2.0   23    4-26     33-55  (76)
 60 COG1916 Uncharacterized homolo  23.8      49  0.0011   28.1   1.6   24    4-27    102-125 (388)
 61 COG1494 GlpX Fructose-1,6-bisp  23.4      56  0.0012   27.3   1.8   19    5-23    169-187 (332)
 62 cd08270 MDR4 Medium chain dehy  23.3      60  0.0013   22.8   1.8   18    4-21    147-164 (305)
 63 cd08261 Zn_ADH7 Alcohol dehydr  23.3      54  0.0012   23.8   1.5   17    4-20    173-189 (337)
 64 cd05280 MDR_yhdh_yhfp Yhdh and  23.1      56  0.0012   23.1   1.6   17    4-20    161-177 (325)
 65 PF08889 WbqC:  WbqC-like prote  23.1      53  0.0011   24.5   1.5   18    4-21    144-161 (219)
 66 cd08293 PTGR2 Prostaglandin re  22.8      61  0.0013   23.5   1.8   17    4-20    169-186 (345)
 67 cd08243 quinone_oxidoreductase  22.3      60  0.0013   22.7   1.6   17    4-20    157-173 (320)
 68 PRK07122 RNA polymerase sigma   22.1      35 0.00075   25.6   0.4   26    2-28     49-74  (264)
 69 cd08289 MDR_yhfp_like Yhfp put  21.6      61  0.0013   23.1   1.5   17    4-20    161-177 (326)
 70 cd08296 CAD_like Cinnamyl alco  21.4      67  0.0015   23.5   1.7   17    4-20    177-193 (333)
 71 PRK12415 fructose 1,6-bisphosp  21.2      67  0.0014   26.5   1.8   21    5-25    169-190 (322)
 72 PF15240 Pro-rich:  Proline-ric  20.9      96  0.0021   23.7   2.5   21   31-51      2-22  (179)
 73 cd08242 MDR_like Medium chain   20.8      65  0.0014   23.1   1.5   17    4-20    169-185 (319)
 74 KOG0024 Sorbitol dehydrogenase  20.6      61  0.0013   27.2   1.5   15    6-20    206-220 (354)
 75 cd05288 PGDH Prostaglandin deh  20.4      68  0.0015   22.9   1.6   17    4-20    160-176 (329)
 76 cd08267 MDR1 Medium chain dehy  20.3      70  0.0015   22.3   1.6   17    4-20    158-174 (319)
 77 PF07905 PucR:  Purine cataboli  20.2      69  0.0015   21.3   1.5   21    4-24     89-109 (123)
 78 cd05285 sorbitol_DH Sorbitol d  20.1      63  0.0014   23.7   1.4   18    3-20    175-193 (343)
 79 COG0604 Qor NADPH:quinone redu  20.1      66  0.0014   24.9   1.5   15    4-18    157-171 (326)
 80 KOG2380 Prephenate dehydrogena  20.1      35 0.00076   29.6   0.0   28    8-35     88-115 (480)
 81 cd08297 CAD3 Cinnamyl alcohol   20.0      71  0.0015   23.2   1.6   18    3-20    179-196 (341)

No 1  
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]
Probab=99.91  E-value=1.4e-25  Score=189.47  Aligned_cols=48  Identities=58%  Similarity=0.937  Sum_probs=46.4

Q ss_pred             CCchhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHHhhcCCc
Q 045775            1 MNATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHWFMKQPV   48 (87)
Q Consensus         1 ~NAkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~~~~~~~   48 (87)
                      +||||||||||||||+||+|||||||||||||||||||||+|++++..
T Consensus       573 ~NAkYaIS~ARKiGa~IyaLPEDIvEV~pKMvltvfA~lM~~~~~~~~  620 (627)
T KOG0046|consen  573 LNAKYAISVARKLGASIYALPEDIVEVNPKMVLTVFASLMAWSLQRQS  620 (627)
T ss_pred             hcchhhHhHHHhhCceEEeccHHHhhhchhhhHHHHHHHHHhcccccc
Confidence            599999999999999999999999999999999999999999999874


No 2  
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton]
Probab=98.83  E-value=9.8e-10  Score=93.72  Aligned_cols=41  Identities=44%  Similarity=0.657  Sum_probs=39.7

Q ss_pred             CCch-hhhh--hhhhhcceEEecchhhhhhchhh-hHHHHHHHHH
Q 045775            1 MNAT-YIIS--IARKLGCSIFLLPEDITEVNQKM-ILTLTASIMH   41 (87)
Q Consensus         1 ~NAk-yaIS--iARKlGa~IfllpEDIveVk~KM-imT~~AsLM~   41 (87)
                      +||| |+||  ++||+||.||+|||||+.|||++ |+|||+|||+
T Consensus       567 ad~rsl~is~~ilRs~~aii~~lpe~in~~r~~Ldvltfi~slma  611 (612)
T COG5069         567 ADARSLAISSKILRSLGAIIKFLPEDINGVRPRLDVLTFIESLMA  611 (612)
T ss_pred             hhhhhhhccHHHHHHhhhHheechhhhcccCccchHHHHHHHHhc
Confidence            4899 9999  99999999999999999999999 9999999996


No 3  
>smart00033 CH Calponin homology domain. Actin binding domains present in duplicate at the N-termini of spectrin-like proteins (including dystrophin, alpha-actinin). These domains cross-link actin filaments into bundles and networks. A calponin homology domain is predicted in yeasst Cdc24p.
Probab=97.98  E-value=6e-06  Score=50.92  Aligned_cols=41  Identities=34%  Similarity=0.497  Sum_probs=36.8

Q ss_pred             CCchhhhhhhhhhcc-eEEecchhhhhhchhhhHHHHHHHHHH
Q 045775            1 MNATYIISIARKLGC-SIFLLPEDITEVNQKMILTLTASIMHW   42 (87)
Q Consensus         1 ~NAkyaISiARKlGa-~IfllpEDIveVk~KMimT~~AsLM~~   42 (87)
                      .|..++++.++++|. .+.+-||||++.+ |+++.++.+||.+
T Consensus        62 ~Ni~~~l~~~~~~g~~~~~~~~~Dl~~~~-k~~~~v~~~l~~~  103 (103)
T smart00033       62 ENINLALSFAEKLGGKLVLFEPEDLVEGN-KLILGVIWTLILL  103 (103)
T ss_pred             HhHHHHHHHHHHcCCeeeccCHHHHhhcc-hHHHHHHHHHHhC
Confidence            488999999999997 5688899999988 9999999999864


No 4  
>PF00307 CH:  Calponin homology (CH) domain;  InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins []. It comprises the following groups of actin-binding domains:  Actinin-type (including spectrin, fimbrin, ABP-280) (see IPR001589 from INTERPRO). Calponin-type (see IPR000557 from INTERPRO).   A comprehensive review of proteins containing this type of actin-binding domains is given in []. The CH domain is involved in actin binding in some members of the family. However in calponins there is evidence that the CH domain is not involved in its actin binding activity []. Most proteins have two copies of the CH domain, however some proteins such as calponin and the human vav proto-oncogene (P15498 from SWISSPROT) have only a single copy. The structure of an example CH-domain has recently been solved []. This entry represents the calponin-homology (CH) domain, a superfamily of actin-binding domains found in cytoskeletal proteins (contain two CH domain in tandem repeat), in regulatory proteins from muscle, and in signal transduction proteins. This domain has a core structure consisting of a 4-helical bundle. This domain is found in:   Calponin, which is involved in the regulation of contractility and organisation of the actin cytoskeleton in smooth muscle cells []. Beta-spectrin, a major component of a submembrane cytoskeletal network connecting actin filaments to integral plasma membrane proteins []. The actin-cross-linking domain of the fimbrin/plastin family of actin filament bundling or cross-linking proteins []. Utrophin,a close homologue of dystrophin []. Dystrophin, the protein found to be defective in Duchenne muscular dystrophy; this protein contains a tandem repeat of two CH domains []. Actin-binding domain of plectin, a large and widely expressed cytolinker protein []. The N-terminal microtubule-binding domain of microtubule-associated protein eb1 (end-binding protein), a member of a conserved family of proteins that localise to the plus-ends of microtubules []. Ras GTPase-activating-like protein rng2, an IQGAP protein that is essential for the assembly of an actomyosin ring during cytokinesis []. Transgelin, which suppresses androgen receptor transactivation [].  ; GO: 0005515 protein binding; PDB: 2DK9_A 1WYL_A 1WKU_B 1TJT_A 3FER_A 2WA7_A 2WA5_A 2WA6_A 2R0O_A 1PXY_A ....
Probab=97.73  E-value=1.9e-05  Score=49.23  Aligned_cols=42  Identities=29%  Similarity=0.523  Sum_probs=37.5

Q ss_pred             Cchhhhhhhhh-hcceEEecchhhh-hhchhhhHHHHHHHHHHh
Q 045775            2 NATYIISIARK-LGCSIFLLPEDIT-EVNQKMILTLTASIMHWF   43 (87)
Q Consensus         2 NAkyaISiARK-lGa~IfllpEDIv-eVk~KMimT~~AsLM~~~   43 (87)
                      |++++++.+++ +|.....-|+||+ +.+.+.||.++..||.+-
T Consensus        64 Ni~~~l~~~~~~lg~~~~~~~~dl~~~~~~~~vl~~l~~l~~~~  107 (108)
T PF00307_consen   64 NIELALEAAEKKLGIPPLLSPEDLVEKGDEKSVLSFLWQLFRYF  107 (108)
T ss_dssp             HHHHHHHHHHHHTTSSCTS-HHHHHSTT-HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCCCCCCHHHHHHCcCHHHHHHHHHHHHHHH
Confidence            78999999999 9999999999999 999999999999999763


No 5  
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity). The CH domain is found in cytoskeletal and signal transduction proteins, including actin-binding proteins like spectrin, alpha-actinin, dystrophin, utrophin, and fimbrin, proteins essential for regulation of cell shape (cortexillins), and signaling proteins (Vav).
Probab=97.42  E-value=8.9e-05  Score=46.26  Aligned_cols=42  Identities=26%  Similarity=0.430  Sum_probs=38.7

Q ss_pred             CCchhhhhhhhhhcceEE-ecchhhh-hhchhhhHHHHHHHHHH
Q 045775            1 MNATYIISIARKLGCSIF-LLPEDIT-EVNQKMILTLTASIMHW   42 (87)
Q Consensus         1 ~NAkyaISiARKlGa~If-llpEDIv-eVk~KMimT~~AsLM~~   42 (87)
                      .|.++++..++++|.... +-|+||+ +.+.|.||+++.+|+..
T Consensus        62 ~Ni~~~l~~~~~~gi~~~~~~~~Dl~~~~n~~~vl~~l~~l~~~  105 (107)
T cd00014          62 ENINLALNFAEKLGVPVVNFDAEDLVEDGDEKLVLGLLWSLIRK  105 (107)
T ss_pred             HHHHHHHHHHHHcCCceeccCHHHHhhCCCceeeHHHHHHHHHh
Confidence            388999999999999999 8999999 99999999999998864


No 6  
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]
Probab=95.14  E-value=0.012  Score=51.33  Aligned_cols=40  Identities=30%  Similarity=0.535  Sum_probs=36.5

Q ss_pred             chhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHH
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHW   42 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~   42 (87)
                      |...+.-|+|+||+=|+.|.|||+.+||+-+-|+|-|+..
T Consensus       325 A~~vLq~Aekl~Cr~~ltp~dvV~G~~kLNLAFVA~lFn~  364 (627)
T KOG0046|consen  325 AELVLQQAEKLDCRRYLTPTDVVAGNPKLNLAFVANLFNT  364 (627)
T ss_pred             HHHHHHHHHhcCCccccCHHHHhcCCchhhHHHHHHhccc
Confidence            5667888999999999999999999999999999988754


No 7  
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]
Probab=63.92  E-value=3.4  Score=34.32  Aligned_cols=17  Identities=35%  Similarity=0.647  Sum_probs=14.7

Q ss_pred             hhhhhhcceEEecchhh
Q 045775            8 SIARKLGCSIFLLPEDI   24 (87)
Q Consensus         8 SiARKlGa~IfllpEDI   24 (87)
                      --|||-||.||++|.|=
T Consensus       283 vAA~~AGA~vFf~P~~~  299 (342)
T COG3480         283 VAAAKAGADVFFVPADN  299 (342)
T ss_pred             HHHHhcCCcEEEecCCc
Confidence            45899999999999863


No 8  
>PF00381 PTS-HPr:  PTS HPr component phosphorylation site;  InterPro: IPR005698 The histidine-containing phosphocarrier protein (HPr) is a central component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), which transfers metabolic carbohydrates across the cell membrane in many bacterial species [, ]. PTS catalyses the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is as follows: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred to Enzyme I (EI) of the PTS, which in turn transfers it to the phosphoryl carrier protein (HPr) [, ]. Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease complex (enzymes EII/EIII).  HPr [, ] is a small cytoplasmic protein of 70 to 90 amino acid residues. In some bacteria, HPr is a domain in a larger protein that includes a EIII(Fru) (IIA) domain and in some cases also the EI domain. A conserved histidine in the N-terminal section of HPr serves as an acceptor for the phosphoryl group of EI. In the central part of HPr, there is a conserved serine which (in Gram-positive bacteria only) is phosphorylated by an ATP-dependent protein kinase; a process which probably play a regulatory role in sugar transport. The overall architecture of the HPr domain has been described as an open faced beta-sandwich in which a beta-sheet is packed against three alpha-helices. Regulatory phosphorylation at the conserved Ser residue does not appear to induce large structural changes to the HPr domain, in particular in the region of the active site [, ].; GO: 0005351 sugar:hydrogen symporter activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system; PDB: 1TXE_A 1QR5_A 1RZR_S 2NZU_L 2OEN_L 2NZV_L 1Y51_B 1Y4Y_A 1Y50_A 2HPR_A ....
Probab=60.57  E-value=8.2  Score=24.15  Aligned_cols=39  Identities=31%  Similarity=0.342  Sum_probs=31.1

Q ss_pred             chhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHHhhcC
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHWFMKQ   46 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~~~~~   46 (87)
                      |.....+|+|++|.|++.-.+ ..|++|=+|-+    |.++.++
T Consensus        19 a~~lv~~a~~~~~~i~i~~~~-~~vdakSil~l----~~L~~~~   57 (84)
T PF00381_consen   19 AAELVQIASKFDSDITIRKGG-KTVDAKSILGL----MSLGAKK   57 (84)
T ss_dssp             HHHHHHHHHTSSSEEEEEETT-EEEETTSHHHH----HHHTBST
T ss_pred             HHHHHHHHhhCCCEEEEEeCc-eeEecCCHHHH----hhhhcCC
Confidence            445678999999999999999 89999988754    5555544


No 9  
>PF11761 CbiG_mid:  Cobalamin biosynthesis central region;  InterPro: IPR021745  Members of this family are involved in cobalamin synthesis. The gene encoded by P72862 from SWISSPROT has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process []. 
Probab=55.20  E-value=8.1  Score=23.59  Aligned_cols=19  Identities=37%  Similarity=0.457  Sum_probs=12.1

Q ss_pred             hhhhhhcceEEecchhhhhh
Q 045775            8 SIARKLGCSIFLLPEDITEV   27 (87)
Q Consensus         8 SiARKlGa~IfllpEDIveV   27 (87)
                      .+||++|++| .=++++..|
T Consensus         6 ~la~~~g~~i-~~~~~~k~v   24 (93)
T PF11761_consen    6 LLARELGWRI-ENREAVKRV   24 (93)
T ss_pred             hhhhhCCCEE-cCHHHHHHH
Confidence            4799999999 233444433


No 10 
>TIGR02899 spore_safA spore coat assembly protein SafA. in which one of which is found in most examples of endospore-forming bacteria. Lysin motifs are repeated in many proteins.
Probab=53.10  E-value=7.2  Score=20.24  Aligned_cols=20  Identities=25%  Similarity=0.474  Sum_probs=15.1

Q ss_pred             hhhhhhhcceEEecchhhhhhchh
Q 045775            7 ISIARKLGCSIFLLPEDITEVNQK   30 (87)
Q Consensus         7 ISiARKlGa~IfllpEDIveVk~K   30 (87)
                      -++|||.|..    +++|.+.|+.
T Consensus         8 ~~IA~~~~~~----~~~l~~~N~~   27 (44)
T TIGR02899         8 WKIAKKYGVD----FDELIQANPQ   27 (44)
T ss_pred             HHHHHHHCcC----HHHHHHHhhc
Confidence            3689999864    7788887763


No 11 
>PF00582 Usp:  Universal stress protein family;  InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA [] reveals an alpha/beta fold similar to that of the Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0577 protein, which binds ATP [], though UspA lacks ATP-binding activity.; GO: 0006950 response to stress; PDB: 3DLO_C 3QTB_A 2PFS_A 3TNJ_A 1JMV_D 3FH0_B 3FDX_B 3AB7_A 3AB8_A 2GM3_F ....
Probab=51.93  E-value=13  Score=22.13  Aligned_cols=18  Identities=28%  Similarity=0.584  Sum_probs=15.0

Q ss_pred             chhhhhhhhhhcceEEec
Q 045775            3 ATYIISIARKLGCSIFLL   20 (87)
Q Consensus         3 AkyaISiARKlGa~Ifll   20 (87)
                      .+|++.+|++.|+.|++|
T Consensus        19 l~~a~~la~~~~~~i~~l   36 (140)
T PF00582_consen   19 LRFALELAKRSGAEITLL   36 (140)
T ss_dssp             HHHHHHHHHHHTCEEEEE
T ss_pred             HHHHHHHHHhhCCeEEEE
Confidence            368999999999997664


No 12 
>PF00107 ADH_zinc_N:  Zinc-binding dehydrogenase;  InterPro: IPR013149 Alcohol dehydrogenase (1.1.1.1 from EC) (ADH) catalyzes the reversible oxidation of alcohols to their corresponding acetaldehyde or ketone with the concomitant reduction of NAD:  alcohol + NAD = aldehyde or ketone + NADH  Currently three structurally and catalytically different types of alcohol dehydrogenases are known:  Zinc-containing 'long-chain' alcohol dehydrogenases. Insect-type, or 'short-chain' alcohol dehydrogenases. Iron-containing alcohol dehydrogenases.  Zinc-containing ADH's [, ] are dimeric or tetrameric enzymes that bind two atoms of zinc per subunit. One of the zinc atom is essential for catalytic activity while the other is not. Both zinc atoms are coordinated by either cysteine or histidine residues; the catalytic zinc is coordinated by two cysteines and one histidine. Zinc-containing ADH's are found in bacteria, mammals, plants, and in fungi. In many species there is more than one isozyme (for example, humans have at least six isozymes, yeast have three, etc.). A number of other zinc-dependent dehydrogenases are closely related to zinc ADH [] and are included in this family.  Sorbitol dehydrogenase (1.1.1.14 from EC) L-threonine 3-dehydrogenase (1.1.1.103 from EC) Glutathione-dependent formaldehyde dehydrogenase (1.1.1.284 from EC) Mannitol dehydrogenase (1.1.1.255 from EC)   In addition, this family includes NADP-dependent quinone oxidoreductase (1.6.5.5 from EC), an enzyme found in bacteria (gene qor), in yeast and in mammals where, in some species such as rodents, it has been recruited as an eye lens protein and is known as zeta-crystallin []. The sequence of quinone oxidoreductase is distantly related to that other zinc-containing alcohol dehydrogenases and it lacks the zinc-ligand residues. The torpedo fish and mammalian synaptic vesicle membrane protein vat-1 is related to qor. This entry represents the cofactor-binding domain of these enzymes, which is normally found towards the C terminus. Structural studies indicate that it forms a classical Rossman fold that reversibly binds NAD(H) [, , ].; GO: 0008270 zinc ion binding, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3PI7_A 3COS_D 1VJ1_A 2ZB3_A 1PIW_B 1Q1N_A 1PS0_A 2EER_B 3KRT_A 1ZSY_A ....
Probab=50.32  E-value=13  Score=23.34  Aligned_cols=16  Identities=19%  Similarity=0.465  Sum_probs=12.5

Q ss_pred             hhhhhhhhhcceEEec
Q 045775            5 YIISIARKLGCSIFLL   20 (87)
Q Consensus         5 yaISiARKlGa~Ifll   20 (87)
                      +++.+||.+|+.|++.
T Consensus         5 ~a~q~ak~~G~~vi~~   20 (130)
T PF00107_consen    5 MAIQLAKAMGAKVIAT   20 (130)
T ss_dssp             HHHHHHHHTTSEEEEE
T ss_pred             HHHHHHHHcCCEEEEE
Confidence            5778888888888765


No 13 
>PF01476 LysM:  LysM domain;  InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation []. This domain may have a general peptidoglycan binding function.; GO: 0016998 cell wall macromolecule catabolic process; PDB: 2DJP_A 3ZQD_A 1Y7M_B 4A52_A 2L9Y_A 1E0G_A.
Probab=47.82  E-value=11  Score=20.31  Aligned_cols=21  Identities=29%  Similarity=0.597  Sum_probs=15.6

Q ss_pred             hhhhhhhcceEEecchhhhhhchhh
Q 045775            7 ISIARKLGCSIFLLPEDITEVNQKM   31 (87)
Q Consensus         7 ISiARKlGa~IfllpEDIveVk~KM   31 (87)
                      -+||+|.|    +-+++|.+.|+++
T Consensus        10 ~~IA~~~~----~~~~~l~~~N~~~   30 (44)
T PF01476_consen   10 WSIAKRYG----ISVDELMELNPNI   30 (44)
T ss_dssp             HHHHHHTT----S-HHHHHHHCCTT
T ss_pred             HHHHhhhh----hhHhHHHHhcCCC
Confidence            36888887    6678898888665


No 14 
>PF00488 MutS_V:  MutS domain V C-terminus.;  InterPro: IPR000432 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. ; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 2WTU_A 1OH7_A 1OH5_B 1W7A_B 1NG9_A 1OH8_B ....
Probab=47.56  E-value=11  Score=28.12  Aligned_cols=20  Identities=50%  Similarity=0.818  Sum_probs=15.9

Q ss_pred             chhhhhhhhhhcceEEecchhhhhh
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEV   27 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveV   27 (87)
                      -.|+|.+||+.|     +|++|++-
T Consensus       205 ~S~ai~iA~~~g-----~p~~II~r  224 (235)
T PF00488_consen  205 SSYAIEIAKLAG-----LPEEIIER  224 (235)
T ss_dssp             STCHHHHHHHTT-------HHHHHH
T ss_pred             CcHHHHHHHHhC-----cCHHHHHH
Confidence            469999999999     79999974


No 15 
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=45.53  E-value=14  Score=27.01  Aligned_cols=21  Identities=19%  Similarity=0.510  Sum_probs=18.0

Q ss_pred             CchhhhhhhhhhcceEEecchhhhhh
Q 045775            2 NATYIISIARKLGCSIFLLPEDITEV   27 (87)
Q Consensus         2 NAkyaISiARKlGa~IfllpEDIveV   27 (87)
                      +-.|+|.+||++|     +|++|++-
T Consensus       193 ~~s~a~~~a~~~g-----~p~~vi~~  213 (222)
T cd03285         193 DQSFGIHVAELAN-----FPKEVIEM  213 (222)
T ss_pred             CCcHHHHHHHHhC-----cCHHHHHH
Confidence            3579999999999     89999874


No 16 
>PRK15118 universal stress global response regulator UspA; Provisional
Probab=44.02  E-value=18  Score=23.29  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=14.9

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .|++++|++.||.|.+|
T Consensus        21 ~~a~~la~~~~a~l~ll   37 (144)
T PRK15118         21 EKAVSMARPYNAKVSLI   37 (144)
T ss_pred             HHHHHHHHhhCCEEEEE
Confidence            57888999999999887


No 17 
>PRK10116 universal stress protein UspC; Provisional
Probab=41.73  E-value=21  Score=22.77  Aligned_cols=17  Identities=35%  Similarity=0.429  Sum_probs=14.9

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      +|++.+|++.|+.+.++
T Consensus        21 ~~A~~lA~~~~a~l~ll   37 (142)
T PRK10116         21 AKAVSIARPVNGKISLI   37 (142)
T ss_pred             HHHHHHHHHhCCEEEEE
Confidence            68899999999998876


No 18 
>COG1920 Predicted nucleotidyltransferase, CobY/MobA/RfbA family [General function prediction only]
Probab=41.54  E-value=19  Score=28.29  Aligned_cols=22  Identities=36%  Similarity=0.540  Sum_probs=18.6

Q ss_pred             hhhhhhhcceEEec-----------chhhhhhc
Q 045775            7 ISIARKLGCSIFLL-----------PEDITEVN   28 (87)
Q Consensus         7 ISiARKlGa~Ifll-----------pEDIveVk   28 (87)
                      ++.|||.|..++..           |||++|+.
T Consensus       149 l~~Ark~G~~~~~~dSf~l~~DVDtpeDL~e~~  181 (210)
T COG1920         149 LEEARKRGLVVLTYDSFGLSADVDTPEDLVEAF  181 (210)
T ss_pred             HHHHHHcCCEEEEecccceecCCCCHHHHHHHH
Confidence            67899999998774           89999863


No 19 
>PRK15005 universal stress protein F; Provisional
Probab=40.89  E-value=19  Score=22.87  Aligned_cols=17  Identities=12%  Similarity=0.137  Sum_probs=14.3

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      +||+.+|++.|+.|+++
T Consensus        22 ~~a~~la~~~~~~l~ll   38 (144)
T PRK15005         22 SHVEAEAKIDDAEVHFL   38 (144)
T ss_pred             HHHHHHHhccCCeEEEE
Confidence            57888999999988865


No 20 
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea . Na+/H+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells. Na+ /H+ exchange activity is also crucial for the regulation of cell volume, and for the reabsorption of NaCl across renal, intestinal, and other epithelia. These antiports exchange Na+ for H+ in an electroneutral manner, and this activity is carried out by a family of Na+ /H+ exchangers, or NHEs, which are known to be present in both prokaryotic and eukaryotic cells.  These exchangers are highly-regulated (glyco)phosphoproteins, which, based on their primary structure, appear to contain 10-12 membrane-spanning regions (M) at the N-terminus and a large cytoplasmic region at the C-terminus. The transmembrane regions M3-M12 share identity wit h other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the regio
Probab=40.63  E-value=19  Score=22.11  Aligned_cols=18  Identities=22%  Similarity=0.218  Sum_probs=15.6

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      .|+..+|++.++.|+++-
T Consensus        17 ~~a~~la~~~~~~v~ll~   34 (132)
T cd01988          17 ELAAALARAQNGEIIPLN   34 (132)
T ss_pred             HHHHHHhhcCCCeEEEEE
Confidence            688999999999998774


No 21 
>PRK09982 universal stress protein UspD; Provisional
Probab=40.34  E-value=21  Score=23.42  Aligned_cols=18  Identities=17%  Similarity=0.276  Sum_probs=15.7

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      ++|+++|++.||.|.++-
T Consensus        21 ~~A~~lA~~~~a~l~llh   38 (142)
T PRK09982         21 NKALELARHNDAHLTLIH   38 (142)
T ss_pred             HHHHHHHHHhCCeEEEEE
Confidence            688999999999998874


No 22 
>KOG0806 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism]
Probab=39.25  E-value=14  Score=29.96  Aligned_cols=23  Identities=30%  Similarity=0.375  Sum_probs=20.2

Q ss_pred             chhhhhhhhhhcceEEecchhhh
Q 045775            3 ATYIISIARKLGCSIFLLPEDIT   25 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIv   25 (87)
                      +.-+|..|+|-|+.|.++|||+.
T Consensus        35 ~~~~i~~aa~~g~~iIv~PE~~~   57 (298)
T KOG0806|consen   35 LEKAVKEAAKQGAKIIVFPEDGL   57 (298)
T ss_pred             HHHHHHHHHhcCCeEEEChhhcc
Confidence            45678899999999999999975


No 23 
>PRK13781 paaB phenylacetate-CoA oxygenase subunit PaaB; Provisional
Probab=38.16  E-value=26  Score=24.43  Aligned_cols=35  Identities=26%  Similarity=0.378  Sum_probs=24.1

Q ss_pred             Cchhhhhhhhhh------cceEEecch-hhhhhchhhhHHHH
Q 045775            2 NATYIISIARKL------GCSIFLLPE-DITEVNQKMILTLT   36 (87)
Q Consensus         2 NAkyaISiARKl------Ga~IfllpE-DIveVk~KMimT~~   36 (87)
                      ++..|+..||.+      |..||++|. +|....|.=.-.||
T Consensus        31 d~e~Al~~Ar~~y~RR~e~vsiWVVp~~~I~as~p~ek~~~f   72 (95)
T PRK13781         31 DAEMALRNARDVYTRRNEGVSIWVVPSSAITASDPDEKGPFF   72 (95)
T ss_pred             CHHHHHHHHHHHhccccCCcEEEEeeHHHccccChhhhhhcc
Confidence            466788888876      899999996 46666665333333


No 24 
>TIGR02157 PA_CoA_Oxy2 phenylacetate-CoA oxygenase, PaaH subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=38.14  E-value=26  Score=24.13  Aligned_cols=35  Identities=17%  Similarity=0.247  Sum_probs=23.9

Q ss_pred             Cchhhhhhhhhh------cceEEecch-hhhhhchhhhHHHH
Q 045775            2 NATYIISIARKL------GCSIFLLPE-DITEVNQKMILTLT   36 (87)
Q Consensus         2 NAkyaISiARKl------Ga~IfllpE-DIveVk~KMimT~~   36 (87)
                      ++..|+..||.+      |..||++|. ||+...|.=.-.||
T Consensus        26 d~e~Al~~Ard~y~RR~e~vsiWVVp~~~I~as~p~ek~~~f   67 (90)
T TIGR02157        26 DEEMALMMARDNYTRREEGVSIWVVKASHIVASTPDEREEFF   67 (90)
T ss_pred             CHHHHHHHHHHHhccccCCcEEEEeeHHHhhcCChhhhhhcc
Confidence            566788888765      889999996 46666665333333


No 25 
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of ac
Probab=35.37  E-value=28  Score=24.89  Aligned_cols=17  Identities=24%  Similarity=0.424  Sum_probs=14.3

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+||.+|+.||++
T Consensus       158 ~~aiqlA~~~G~~vi~~  174 (329)
T cd08294         158 SLVGQIAKIKGCKVIGC  174 (329)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            46889999999998864


No 26 
>PF03686 UPF0146:  Uncharacterised protein family (UPF0146);  InterPro: IPR005353 The function of this family of proteins is unknown.; PDB: 2K4M_A.
Probab=35.18  E-value=28  Score=25.06  Aligned_cols=18  Identities=28%  Similarity=0.676  Sum_probs=14.0

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      .+.+.+|||.||..++.|
T Consensus        85 ~~il~lA~~v~adlii~p  102 (127)
T PF03686_consen   85 PPILELAKKVGADLIIRP  102 (127)
T ss_dssp             HHHHHHHHHHT-EEEEE-
T ss_pred             HHHHHHHHHhCCCEEEEC
Confidence            467899999999999877


No 27 
>PRK04148 hypothetical protein; Provisional
Probab=32.87  E-value=29  Score=24.75  Aligned_cols=18  Identities=22%  Similarity=0.722  Sum_probs=15.6

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      .+.+.+|||+||..++.|
T Consensus        92 ~~~~~la~~~~~~~~i~~  109 (134)
T PRK04148         92 PFILELAKKINVPLIIKP  109 (134)
T ss_pred             HHHHHHHHHcCCCEEEEc
Confidence            367889999999999887


No 28 
>COG1255 Uncharacterized protein conserved in archaea [Function unknown]
Probab=31.30  E-value=32  Score=25.32  Aligned_cols=18  Identities=22%  Similarity=0.739  Sum_probs=16.1

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      +|.+-+|||.||..|+.|
T Consensus        85 ~~ildva~aVga~l~I~p  102 (129)
T COG1255          85 SAILDVAKAVGAPLYIKP  102 (129)
T ss_pred             HHHHHHHHhhCCCEEEEe
Confidence            467889999999999988


No 29 
>TIGR00330 glpX fructose-1,6-bisphosphatase, class II. In E. coli, GlpX is found in the glpFKX operon together with a glycerol update protein and glycerol kinase.
Probab=31.02  E-value=34  Score=28.30  Aligned_cols=21  Identities=29%  Similarity=0.736  Sum_probs=18.1

Q ss_pred             hhhhhhhhhcceEEecch-hhh
Q 045775            5 YIISIARKLGCSIFLLPE-DIT   25 (87)
Q Consensus         5 yaISiARKlGa~IfllpE-DIv   25 (87)
                      ..|.-.|+.||+|.|+++ ||.
T Consensus       168 ~lI~eiR~~Gari~Li~DGDVa  189 (321)
T TIGR00330       168 AVIAEMQQLGVRVFAIPDGDVA  189 (321)
T ss_pred             HHHHHHHHcCCeEEEeccccHH
Confidence            467889999999999999 873


No 30 
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase. Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase.
Probab=30.60  E-value=34  Score=24.87  Aligned_cols=17  Identities=24%  Similarity=0.391  Sum_probs=14.0

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+||..|+.||++
T Consensus       153 ~~aiqlAk~~G~~Vi~~  169 (325)
T TIGR02825       153 SVVGQIAKLKGCKVVGA  169 (325)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            46889999999988864


No 31 
>PF07085 DRTGG:  DRTGG domain;  InterPro: IPR010766 This presumed domain is about 120 amino acids in length. It is found associated with CBS domains IPR000644 from INTERPRO, as well as the CbiA domain IPR002586 from INTERPRO. The function of this domain is unknown. It is named the DRTGG domain after some of the most conserved residues. This domain may be very distantly related to a pair of CBS domains. There are no significant sequence similarities, but its length and association with CBS domains supports this idea. ; PDB: 3L31_B 3L2B_A 2IOJ_A.
Probab=29.46  E-value=51  Score=21.02  Aligned_cols=24  Identities=25%  Similarity=0.465  Sum_probs=17.8

Q ss_pred             hhhhhhhhhhcceEEecchhhhhh
Q 045775            4 TYIISIARKLGCSIFLLPEDITEV   27 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDIveV   27 (87)
                      +..+..|++.|+.|+..|.|--++
T Consensus        75 ~~v~~la~~~~i~vi~t~~dtf~t   98 (105)
T PF07085_consen   75 EEVLELAKELGIPVISTPYDTFET   98 (105)
T ss_dssp             HHHHHHHHHHT-EEEE-SS-HHHH
T ss_pred             HHHHHHHHHCCCEEEEECCCHHHH
Confidence            457889999999999999997665


No 32 
>PF06821 Ser_hydrolase:  Serine hydrolase;  InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic. The Crystal Structure Of The Yden Gene Product Swiss:P96671 from B. Subtilis has been solved. The structure shows an alpha-beta hydrolase fold suggesting an enzymatic function for these proteins [].; GO: 0016787 hydrolase activity; PDB: 3BDV_B 2QS9_A 1UXO_A.
Probab=29.02  E-value=41  Score=23.81  Aligned_cols=19  Identities=21%  Similarity=0.424  Sum_probs=15.5

Q ss_pred             hhhhhhhhhhcceEEecch
Q 045775            4 TYIISIARKLGCSIFLLPE   22 (87)
Q Consensus         4 kyaISiARKlGa~IfllpE   22 (87)
                      +++..+|+++||.++.+|.
T Consensus       131 ~~a~~~A~~l~a~~~~~~~  149 (171)
T PF06821_consen  131 ERAQRLAQRLGAELIILGG  149 (171)
T ss_dssp             HHHHHHHHHHT-EEEEETS
T ss_pred             HHHHHHHHHcCCCeEECCC
Confidence            4678899999999998874


No 33 
>PRK11175 universal stress protein UspE; Provisional
Probab=29.02  E-value=36  Score=24.61  Aligned_cols=17  Identities=18%  Similarity=0.239  Sum_probs=14.7

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      +||+.+|++.||.+.+|
T Consensus        21 ~~a~~lA~~~~a~l~ll   37 (305)
T PRK11175         21 RRAVYLAQRNGGKITAF   37 (305)
T ss_pred             HHHHHHHHhcCCCEEEE
Confidence            68999999999998754


No 34 
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=28.94  E-value=37  Score=24.56  Aligned_cols=18  Identities=11%  Similarity=0.447  Sum_probs=15.3

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      ..++.+||.+||.||.+-
T Consensus       192 ~~~~~~a~~~g~~vi~~~  209 (350)
T cd08274         192 SALVQLAKRRGAIVIAVA  209 (350)
T ss_pred             HHHHHHHHhcCCEEEEEe
Confidence            568899999999998864


No 35 
>PF00682 HMGL-like:  HMGL-like of this family is not conserved in other members. are a sub-families of this Pfam.;  InterPro: IPR000891  Pyruvate carboxylase (6.4.1.1 from EC) (PC), a member of the biotin-dependent enzyme family, is involved in the gluconeogenesis by mediating the carboxylation of pyruvate to oxaloacetate. Biotin-dependent carboxylase enzymes perform a two step reaction. Enzyme-bound biotin is first carboxylated by bicarbonate and ATP and the carboxyl group temporarily bound to biotin is subsequently transferred to an acceptor substrate such as pyruvate []. PC has three functional domains: a biotin carboxylase (BC) domain, a carboxyltransferase (CT) domain which perform the second part of the reaction and a biotinyl domain [, ]. The mechanism by which the carboxyl group is transferred from the carboxybiotin to the pyruvate is not well understood.   The pyruvate carboxyltransferase domain is also found in other pyruvate binding enzymes and acetyl-CoA dependent enzymes suggesting that this domain can be associated with different enzymatic activities. This domain is found towards the N-terminal region of various aldolase enzymes. This N-terminal TIM barrel domain [] interacts with the C-terminal domain. The C-terminal DmpG_comm domain (IPR012425 from INTERPRO) is thought to promote heterodimerisation with members of IPR003361 from INTERPRO to form a bifunctional aldolase-dehydrogenase []. ; GO: 0003824 catalytic activity; PDB: 3MP5_E 3MP3_E 2CW6_E 3MP4_D 3HBL_A 3HB9_C 3HO8_A 3BG5_C 1YDN_B 3RMJ_A ....
Probab=28.88  E-value=95  Score=22.12  Aligned_cols=40  Identities=18%  Similarity=0.267  Sum_probs=34.0

Q ss_pred             chhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHH
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHW   42 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~   42 (87)
                      ++-++..||++|..|++-++|.-...+.-++-++--+...
T Consensus       110 ~~~~v~~ak~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~  149 (237)
T PF00682_consen  110 IEEAVKYAKELGYEVAFGCEDASRTDPEELLELAEALAEA  149 (237)
T ss_dssp             HHHHHHHHHHTTSEEEEEETTTGGSSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCceEeCccccccccHHHHHHHHHHHHHc
Confidence            4567899999999999999999999998888887766554


No 36 
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). While some current members of this family carry designations as putative alginate lyase, it seems no sequence with a direct characterization as such is detected by this model.
Probab=28.83  E-value=40  Score=24.26  Aligned_cols=17  Identities=29%  Similarity=0.616  Sum_probs=14.7

Q ss_pred             hhhhhhhhhh-cceEEec
Q 045775            4 TYIISIARKL-GCSIFLL   20 (87)
Q Consensus         4 kyaISiARKl-Ga~Ifll   20 (87)
                      .+++.+||.+ |+.||.+
T Consensus       163 ~~~~~~ak~~~G~~vi~~  180 (336)
T TIGR02817       163 SILIQLARQLTGLTVIAT  180 (336)
T ss_pred             HHHHHHHHHhCCCEEEEE
Confidence            5788999998 9999886


No 37 
>TIGR01003 PTS_HPr_family Phosphotransferase System HPr (HPr) Family. The HPr family are bacterial proteins (or domains of proteins) which function in phosphoryl transfer system (PTS) systems. They include energy-coupling components which catalyze sugar uptake via a group translocation mechanism. The functions of most of these proteins are not known, but they presumably function in PTS-related regulatory capacities. All seed members are stand-alone HPr proteins, although the model also recognizes HPr domains of PTS fusion proteins. This family includes the related NPr protein.
Probab=28.62  E-value=52  Score=20.77  Aligned_cols=40  Identities=30%  Similarity=0.331  Sum_probs=29.5

Q ss_pred             chhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHHhhcCC
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHWFMKQP   47 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~~~~~~   47 (87)
                      |-.....|+|..|.|++.-.+ ..+++|=||    +||.++.++.
T Consensus        19 A~~lv~~a~~f~s~I~i~~~~-~~~dakSil----~ll~Lg~~~G   58 (82)
T TIGR01003        19 AAILVKLASGFDSEITLTKNG-KEVNAKSIM----GIMMLGAGQG   58 (82)
T ss_pred             HHHHHHHHHhCCCEEEEEECC-EEEehHhHH----HHHhcCCCCC
Confidence            345678899999999998776 567887665    4566666653


No 38 
>PRK12388 fructose-1,6-bisphosphatase II-like protein; Reviewed
Probab=28.53  E-value=40  Score=27.86  Aligned_cols=21  Identities=38%  Similarity=0.706  Sum_probs=17.9

Q ss_pred             hhhhhhhhhcceEEecch-hhh
Q 045775            5 YIISIARKLGCSIFLLPE-DIT   25 (87)
Q Consensus         5 yaISiARKlGa~IfllpE-DIv   25 (87)
                      ..|.-.|+.||+|.|+|+ |+.
T Consensus       168 ~lI~eiR~~GarI~Li~DGDVa  189 (321)
T PRK12388        168 AAIEEATQLGVKVFALPDGDVA  189 (321)
T ss_pred             HHHHHHHHcCCeEEEeccccHH
Confidence            357778999999999999 873


No 39 
>PF08673 RsbU_N:  Phosphoserine phosphatase RsbU, N-terminal domain;  InterPro: IPR014787 The phosphoserine phosphatase RsbU acts as a positive regulator of the general stress-response factor of Gram-positive organisms, sigma-B. RsbU dephosphorylates rsbV in response to environmental stress conveyed from the rsbXST module. The phosphatase activity of RsbU is stimulated during the stress response by associating with the RsbT kinase. This association leads to the induction of sigmaB activity. The N-terminal domain forms a helix-swapped dimer that is otherwise similar to the KaiA domain dimer. Deletions in the N-terminal domain are deleterious to the activity of RsbU. The C-terminal domain of RsbU is similar to the catalytic domains of PP2C-type phosphatases [].; PDB: 2J6Y_D 2J6Z_A 2J70_A 1W53_A.
Probab=28.15  E-value=31  Score=22.52  Aligned_cols=20  Identities=30%  Similarity=0.614  Sum_probs=14.3

Q ss_pred             ecchhhhhhchhhhHHHHHH
Q 045775           19 LLPEDITEVNQKMILTLTAS   38 (87)
Q Consensus        19 llpEDIveVk~KMimT~~As   38 (87)
                      +.|||||++--+.|..+..+
T Consensus        35 I~PEeIv~iH~~~v~~l~~~   54 (77)
T PF08673_consen   35 ISPEEIVEIHKSAVQELSPS   54 (77)
T ss_dssp             --HHHHHHHHHHHHHHH-TT
T ss_pred             CCHHHHHHHHHHHHHHHccc
Confidence            68999999988888776654


No 40 
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase.  The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism.  Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in
Probab=28.01  E-value=43  Score=24.61  Aligned_cols=17  Identities=18%  Similarity=0.303  Sum_probs=14.3

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+||.+|+.|+.+
T Consensus       166 ~~aiqlAk~~G~~Vi~~  182 (338)
T cd08295         166 QLVGQLAKLKGCYVVGS  182 (338)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            47889999999998874


No 41 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=27.76  E-value=33  Score=30.30  Aligned_cols=26  Identities=27%  Similarity=0.469  Sum_probs=20.4

Q ss_pred             chhhhhhhhhhcceEEecchhhhhhchhhhH
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEVNQKMIL   33 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveVk~KMim   33 (87)
                      .-|||.|||++|     +|++|++-=-+++-
T Consensus       482 ~S~a~~iA~~~G-----lp~~ii~~A~~~~~  507 (771)
T TIGR01069       482 ESYAFEIAQRYG-----IPHFIIEQAKTFYG  507 (771)
T ss_pred             CcHHHHHHHHhC-----cCHHHHHHHHHHHH
Confidence            359999999999     89999986554443


No 42 
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordina
Probab=27.71  E-value=44  Score=23.72  Aligned_cols=18  Identities=17%  Similarity=0.237  Sum_probs=15.5

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      ..++.+|+++|+.||++-
T Consensus       154 ~~~~~~a~~~G~~v~~~~  171 (324)
T cd08292         154 KLVAMLAAARGINVINLV  171 (324)
T ss_pred             HHHHHHHHHCCCeEEEEe
Confidence            467899999999999874


No 43 
>PF03465 eRF1_3:  eRF1 domain 3;  InterPro: IPR005142  This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre. The crystal structure of human eRF1 is known []. The overall shape and dimensions of eRF1 resemble a tRNA molecule with domains 1, 2, and 3 of eRF1 corresponding to the anticodon loop, aminoacyl acceptor stem, and T stem of a tRNA molecule, respectively. The position of the essential GGQ motif at an exposed tip of domain 2 suggests that the Gln residue coordinates a water molecule to mediate the hydrolytic activity at the peptidyl transferase centre. A conserved groove on domain 1, 80 A from the GGQ motif, is proposed to form the codon recognition site []. This domain is also found in other proteins which may also be involved in translation termination but this awaits experimental verification.; PDB: 3OBY_A 3E1Y_D 1DT9_A 2KTU_A 2KTV_A 3IR9_A 3E20_H 3OBW_A 3AGJ_F 3MCA_B ....
Probab=27.41  E-value=51  Score=22.15  Aligned_cols=22  Identities=14%  Similarity=0.338  Sum_probs=17.6

Q ss_pred             hhhhhhhhhhcceEEecchhhh
Q 045775            4 TYIISIARKLGCSIFLLPEDIT   25 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDIv   25 (87)
                      -+.+..|.+.|+.|+++|.+=-
T Consensus        72 ~~l~~~a~~~g~~v~iis~~~e   93 (113)
T PF03465_consen   72 EELIELAEQSGAKVEIISSEHE   93 (113)
T ss_dssp             HHHHHHHHHTTSEEEEE-TTSH
T ss_pred             HHHHHHHHHcCCEEEEEcCCCc
Confidence            4578899999999999998743


No 44 
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=27.33  E-value=38  Score=23.80  Aligned_cols=20  Identities=10%  Similarity=0.310  Sum_probs=15.8

Q ss_pred             chhhhhhhhhhcce-EEecch
Q 045775            3 ATYIISIARKLGCS-IFLLPE   22 (87)
Q Consensus         3 AkyaISiARKlGa~-IfllpE   22 (87)
                      ..+++.+||++|+. |+++--
T Consensus       142 g~~~~~la~~~g~~~v~~~~~  162 (312)
T cd08269         142 GLLFLQLAAAAGARRVIAIDR  162 (312)
T ss_pred             HHHHHHHHHHcCCcEEEEECC
Confidence            35788999999999 887643


No 45 
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain. This family of bacterial enzymes is sequence-similar to 4-hydroxy-2-oxovalerate aldolase (HOA) but its exact function is unknown.  This family includes the Bacteroides vulgatus Bvu_2661 protein and belongs to the DRE-TIM metallolyase superfamily.  DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC.  These members all share a conserved  triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices.  The domain has a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues t
Probab=26.72  E-value=58  Score=24.66  Aligned_cols=41  Identities=17%  Similarity=0.231  Sum_probs=34.0

Q ss_pred             CchhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHH
Q 045775            2 NATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHW   42 (87)
Q Consensus         2 NAkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~   42 (87)
                      |++-+|..||+.|..|++-++|.....+..+.-++.-+...
T Consensus       110 ~~~~~i~~ak~~G~~v~~~~~~a~~~~~~~~~~~~~~~~~~  150 (266)
T cd07944         110 EALPLIKAIKEKGYEVFFNLMAISGYSDEELLELLELVNEI  150 (266)
T ss_pred             HHHHHHHHHHHCCCeEEEEEEeecCCCHHHHHHHHHHHHhC
Confidence            46778999999999999999999998888888777655443


No 46 
>PRK13782 phosphocarrier protein Chr; Provisional
Probab=26.55  E-value=60  Score=20.49  Aligned_cols=39  Identities=21%  Similarity=0.359  Sum_probs=29.0

Q ss_pred             hhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHHhhcCC
Q 045775            4 TYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHWFMKQP   47 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~~~~~~   47 (87)
                      ......|+|..|.|++.-.+ ..|++|=||-    ||.+..++.
T Consensus        20 ~~lv~~a~~f~~~i~l~~~~-~~vdaKSil~----llsLg~~~g   58 (82)
T PRK13782         20 ALFVQEANRFHADIFIEKDG-KKVNAKSIMG----LMSLAIGTG   58 (82)
T ss_pred             HHHHHHHHhCCCEEEEEECC-eEEecHhHHH----HHhcCCCCC
Confidence            34567899999999998766 5788887764    566666653


No 47 
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine  kinases. The Serine Threonine  kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain  is predicted to be involved in ATP binding.
Probab=26.38  E-value=35  Score=21.80  Aligned_cols=17  Identities=18%  Similarity=0.309  Sum_probs=14.4

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      +|++.+|++.|+.+.++
T Consensus        17 ~~a~~~a~~~~~~l~ll   33 (146)
T cd01989          17 KWALDNLATKGQTIVLV   33 (146)
T ss_pred             HHHHHhccCCCCcEEEE
Confidence            57888899899998876


No 48 
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases. Yhdh putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catal
Probab=25.63  E-value=50  Score=23.51  Aligned_cols=17  Identities=12%  Similarity=0.348  Sum_probs=14.6

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      +.++.+||.+|+.||.+
T Consensus       161 ~~~~~~A~~~G~~vi~~  177 (324)
T cd08288         161 SVAVALLARLGYEVVAS  177 (324)
T ss_pred             HHHHHHHHHCCCeEEEE
Confidence            56889999999998875


No 49 
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family. The family of KdpD sensor kinase proteins regulates the kdpFABC operon responsible for potassium transport. The USP domain is homologous to the universal stress protein Usp Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity.
Probab=25.22  E-value=51  Score=20.42  Aligned_cols=17  Identities=12%  Similarity=0.286  Sum_probs=13.9

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ++++.+|++.|+.++++
T Consensus        17 ~~a~~la~~~~~~l~ll   33 (124)
T cd01987          17 RRAARLADRLKAPWYVV   33 (124)
T ss_pred             HHHHHHHHHhCCCEEEE
Confidence            57788999999988765


No 50 
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordin
Probab=25.17  E-value=52  Score=23.93  Aligned_cols=17  Identities=6%  Similarity=0.323  Sum_probs=14.2

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+||.+|+.|+++
T Consensus       158 ~~a~q~a~~~G~~vi~~  174 (324)
T cd08291         158 RMLVRLCKADGIKVINI  174 (324)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            46788999999998875


No 51 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=24.91  E-value=40  Score=29.79  Aligned_cols=25  Identities=44%  Similarity=0.749  Sum_probs=19.8

Q ss_pred             chhhhhhhhhhcceEEecchhhhhhchhhh
Q 045775            3 ATYIISIARKLGCSIFLLPEDITEVNQKMI   32 (87)
Q Consensus         3 AkyaISiARKlGa~IfllpEDIveVk~KMi   32 (87)
                      .-|||.+||++|     +|++|++-=-+++
T Consensus       487 ~S~a~~iA~~~G-----lp~~ii~~A~~~~  511 (782)
T PRK00409        487 KSNAFEIAKRLG-----LPENIIEEAKKLI  511 (782)
T ss_pred             CcHHHHHHHHhC-----cCHHHHHHHHHHH
Confidence            358999999999     8999998654443


No 52 
>cd08244 MDR_enoyl_red Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydr
Probab=24.73  E-value=55  Score=23.17  Aligned_cols=18  Identities=11%  Similarity=0.379  Sum_probs=15.3

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      ..++.+||++|+.||.+-
T Consensus       157 ~~~~~la~~~g~~v~~~~  174 (324)
T cd08244         157 SLLVQLAKAAGATVVGAA  174 (324)
T ss_pred             HHHHHHHHHCCCEEEEEe
Confidence            568899999999998863


No 53 
>PF02348 CTP_transf_3:  Cytidylyltransferase;  InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2.7.7.43 from EC) (CMP-NeuAc synthetase) catalyzes the reaction of CTP and NeuAc to form CMP-NeuAc, which is the nucleotide sugar donor used by sialyltransferases []. The outer membrane lipooligosaccharides of some microorganisms contain terminal sialic acid attached to N-acetyllactosamine and so this modification may be important in pathogenesis.; GO: 0009103 lipopolysaccharide biosynthetic process; PDB: 3K8D_C 1VH1_B 3K8E_C 1QWJ_A 3EWI_A 1VIC_B 3DUV_A 1VH3_C 3TQD_A 2Y6P_C ....
Probab=24.65  E-value=74  Score=21.86  Aligned_cols=31  Identities=16%  Similarity=0.348  Sum_probs=23.8

Q ss_pred             hhhhhhhhcceEEecchhhhhhchhhhHHHH
Q 045775            6 IISIARKLGCSIFLLPEDITEVNQKMILTLT   36 (87)
Q Consensus         6 aISiARKlGa~IfllpEDIveVk~KMimT~~   36 (87)
                      ...+|++.|+.|+..|+++..+..+++-.+-
T Consensus        52 i~~~~~~~g~~v~~~~~~~~~~~~r~~~~~~   82 (217)
T PF02348_consen   52 IDDIAEEYGAKVIFRRGSLADDTDRFIEAIK   82 (217)
T ss_dssp             HHHHHHHTTSEEEE--TTSSSHHHHHHHHHH
T ss_pred             HHHHHHHcCCeeEEcChhhcCCcccHHHHHH
Confidence            4578999999999999999999888764443


No 54 
>cd01516 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded. A dimeric enzyme dependent on Mg(2+). glpX-encoded FPBase (FBPase class II) differs from other members of the inositol-phosphatase superfamily by permutation of secondary structure elements. The core structure around the active site is well preserved. In E. coli, FBPase II is part of the glp regulon, which mediates growth on glycerol or sn-glycerol 3-phosphate as the sole carbon source.
Probab=24.48  E-value=53  Score=27.02  Aligned_cols=20  Identities=35%  Similarity=0.642  Sum_probs=17.7

Q ss_pred             hhhhhhhhhcceEEecch-hh
Q 045775            5 YIISIARKLGCSIFLLPE-DI   24 (87)
Q Consensus         5 yaISiARKlGa~IfllpE-DI   24 (87)
                      ..|.-.|+.||+|.|+++ ||
T Consensus       168 ~lI~eiR~~Gari~Li~DGDV  188 (309)
T cd01516         168 ALIEEIREAGARIKLIPDGDV  188 (309)
T ss_pred             HHHHHHHHcCCeEEEeccccH
Confidence            457788999999999999 87


No 55 
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=24.46  E-value=50  Score=26.96  Aligned_cols=11  Identities=36%  Similarity=0.534  Sum_probs=5.7

Q ss_pred             hhhhcceEEec
Q 045775           10 ARKLGCSIFLL   20 (87)
Q Consensus        10 ARKlGa~Ifll   20 (87)
                      ||||||..++.
T Consensus       206 a~~lGAd~~i~  216 (339)
T COG1064         206 AKKLGADHVIN  216 (339)
T ss_pred             HHHhCCcEEEE
Confidence            45555555554


No 56 
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain. FrbC (NifV) of Streptomyces rubellomurinus catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate and CoA, a reaction similar to one catalyzed by homocitrate synthase.  The gene encoding FrbC is one of several genes required for the biosynthesis of FR900098, a potent antimalarial antibiotic.  This protein is also required for assembly of the nitrogenase MoFe complex but its exact role is unknown.   This family also includes the NifV proteins of Heliobacterium chlorum and Gluconacetobacter diazotrophicus, which appear to be orthologous to FrbC.  This family belongs to the DRE-TIM metallolyase superfamily.  DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarbox
Probab=24.30  E-value=80  Score=23.39  Aligned_cols=42  Identities=10%  Similarity=0.126  Sum_probs=34.9

Q ss_pred             CchhhhhhhhhhcceEEecchhhhhhchhhhHHHHHHHHHHh
Q 045775            2 NATYIISIARKLGCSIFLLPEDITEVNQKMILTLTASIMHWF   43 (87)
Q Consensus         2 NAkyaISiARKlGa~IfllpEDIveVk~KMimT~~AsLM~~~   43 (87)
                      |++-++..||+.|..|.+-++|.-...+..+.-++.-+....
T Consensus       111 ~~~~~i~~a~~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~G  152 (259)
T cd07939         111 QLRRLVGRAKDRGLFVSVGAEDASRADPDFLIEFAEVAQEAG  152 (259)
T ss_pred             HHHHHHHHHHHCCCeEEEeeccCCCCCHHHHHHHHHHHHHCC
Confidence            345678899999999999999999999999988888665543


No 57 
>cd05286 QOR2 Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone 
Probab=24.18  E-value=55  Score=22.44  Aligned_cols=17  Identities=18%  Similarity=0.296  Sum_probs=14.8

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ..++.+||.+|+.||.+
T Consensus       151 ~~~~~~a~~~g~~v~~~  167 (320)
T cd05286         151 LLLTQWAKALGATVIGT  167 (320)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            46789999999999886


No 58 
>cd07574 nitrilase_Rim1_like Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases). Some members of this subgroup are implicated in post-translational modification, as they contain an N-terminal GCN5-related N-acetyltransferase (GNAT) protein RimI family domain. The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 12. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.
Probab=24.17  E-value=41  Score=24.28  Aligned_cols=21  Identities=24%  Similarity=0.536  Sum_probs=16.5

Q ss_pred             hhhhhhhhhhcceEEecchhh
Q 045775            4 TYIISIARKLGCSIFLLPEDI   24 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDI   24 (87)
                      +-.|.-|.+-||.+.++||--
T Consensus        24 ~~~i~~A~~~gadlivfPE~~   44 (280)
T cd07574          24 EYWVAEAAGYGADLLVFPEYF   44 (280)
T ss_pred             HHHHHHHHHcCCCEEECchHh
Confidence            345667788899999999953


No 59 
>PF08032 SpoU_sub_bind:  RNA 2'-O ribose methyltransferase substrate binding;  InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications. While the biological role of many of these modifications is unknown, some have been shown to be necessary for cell growth or for resistance to antibiotics [, ]. One of the most common modifications is 2'O-ribose methylation catalysed by the RNA 2'O-ribose methyltransferases, a large enzyme family that transfer a methyl group from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of the backbone ribose []. This entry represents a substrate-binding domain found in a variety of bacterial and mitochondrial RNA 2'-O ribose methyltransferases. These include the bacterial enzyme RlmB, which specifically methylates the conserved nucleotide guanosine 2251 in 23S RNA, and PET56, which specifically methylates the equivalent guanosine in mitochondrial 21S RNA [, ]. This domain forms a four-stranded mixed beta sheet similar to that found in other RNA binding enzymes []. It shows considerable conformational flexibility which is thought to be important for its ability to bind RNA.; GO: 0008168 methyltransferase activity; PDB: 1GZ0_D 1IPA_A.
Probab=23.95  E-value=74  Score=18.67  Aligned_cols=23  Identities=17%  Similarity=0.479  Sum_probs=17.5

Q ss_pred             hhhhhhhhhhcceEEecchhhhh
Q 045775            4 TYIISIARKLGCSIFLLPEDITE   26 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDIve   26 (87)
                      +..+..+++.|..|+.+++++.+
T Consensus        33 ~~i~~~~~~~~i~v~~v~~~~l~   55 (76)
T PF08032_consen   33 KEILKLAKKKGIPVYEVSKKVLD   55 (76)
T ss_dssp             HHHHHHHHHCT-EEEEE-HHHHH
T ss_pred             HHHHHHHHHcCCeEEEeCHHHHH
Confidence            45788899999999999998754


No 60 
>COG1916 Uncharacterized homolog of PrgY (pheromone shutdown protein) [Function unknown]
Probab=23.79  E-value=49  Score=28.09  Aligned_cols=24  Identities=33%  Similarity=0.463  Sum_probs=20.8

Q ss_pred             hhhhhhhhhhcceEEecchhhhhh
Q 045775            4 TYIISIARKLGCSIFLLPEDITEV   27 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDIveV   27 (87)
                      |=||-+||++||.|++.--||-=.
T Consensus       102 k~AIe~A~e~ga~V~lIDRdI~vT  125 (388)
T COG1916         102 KAAIEAARELGAPVALIDRDIGVT  125 (388)
T ss_pred             HHHHHHHHHcCCCEEEecccHHHH
Confidence            558999999999999999998543


No 61 
>COG1494 GlpX Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase and related proteins [Carbohydrate transport and metabolism]
Probab=23.43  E-value=56  Score=27.29  Aligned_cols=19  Identities=26%  Similarity=0.506  Sum_probs=16.5

Q ss_pred             hhhhhhhhhcceEEecchh
Q 045775            5 YIISIARKLGCSIFLLPED   23 (87)
Q Consensus         5 yaISiARKlGa~IfllpED   23 (87)
                      ..|.-.|..||+|+|+|+-
T Consensus       169 ~lI~~ir~~GarV~li~DG  187 (332)
T COG1494         169 ELIAEIRAAGARVRLIPDG  187 (332)
T ss_pred             HHHHHHHHhCCEEEEecCc
Confidence            4678889999999999983


No 62 
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=23.34  E-value=60  Score=22.81  Aligned_cols=18  Identities=11%  Similarity=0.327  Sum_probs=15.3

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      +.++.+||++|+.||.+-
T Consensus       147 ~~~~~~a~~~g~~v~~~~  164 (305)
T cd08270         147 RFAVQLAALAGAHVVAVV  164 (305)
T ss_pred             HHHHHHHHHcCCEEEEEe
Confidence            567899999999998873


No 63 
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase,
Probab=23.28  E-value=54  Score=23.82  Aligned_cols=17  Identities=18%  Similarity=0.436  Sum_probs=15.0

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ..++.+||++|+.||++
T Consensus       173 ~~a~~lA~~~g~~v~~~  189 (337)
T cd08261         173 LGVIQVAKARGARVIVV  189 (337)
T ss_pred             HHHHHHHHHcCCeEEEE
Confidence            56899999999999977


No 64 
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases. Yhdh and yhfp-like putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and so
Probab=23.14  E-value=56  Score=23.12  Aligned_cols=17  Identities=29%  Similarity=0.534  Sum_probs=13.7

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ..++.+||.+|+.||++
T Consensus       161 ~~~~~~a~~~g~~v~~~  177 (325)
T cd05280         161 SIAVAILAKLGYTVVAL  177 (325)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            45788999999998865


No 65 
>PF08889 WbqC:  WbqC-like protein family;  InterPro: IPR014985 This family of proteins are functionally uncharacterised. However, it is found in an O-antigen gene cluster in Escherichia coli [] and other bacteria [] suggesting a role in O-antigen production. It has been suggested that wbnG may code for a glycine transferase []. 
Probab=23.06  E-value=53  Score=24.50  Aligned_cols=18  Identities=22%  Similarity=0.497  Sum_probs=15.4

Q ss_pred             hhhhhhhhhhcceEEecc
Q 045775            4 TYIISIARKLGCSIFLLP   21 (87)
Q Consensus         4 kyaISiARKlGa~Ifllp   21 (87)
                      ..+|.++|++||+-|+-|
T Consensus       144 ~~vi~i~~~~ga~~Yi~~  161 (219)
T PF08889_consen  144 ERVIDICKALGADTYING  161 (219)
T ss_pred             HHHHHHHHHcCCCeeecC
Confidence            468999999999999754


No 66 
>cd08293 PTGR2 Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acid
Probab=22.84  E-value=61  Score=23.54  Aligned_cols=17  Identities=29%  Similarity=0.530  Sum_probs=14.1

Q ss_pred             hhhhhhhhhhcc-eEEec
Q 045775            4 TYIISIARKLGC-SIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa-~Ifll   20 (87)
                      .++|.+||.+|+ .||++
T Consensus       169 ~~aiqlAk~~G~~~Vi~~  186 (345)
T cd08293         169 SLAGQIGRLLGCSRVVGI  186 (345)
T ss_pred             HHHHHHHHHcCCCEEEEE
Confidence            468899999998 68875


No 67 
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=22.33  E-value=60  Score=22.67  Aligned_cols=17  Identities=18%  Similarity=0.337  Sum_probs=14.3

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ..++.+|+..|+.||++
T Consensus       157 ~~~~~~a~~~g~~v~~~  173 (320)
T cd08243         157 LAALKLAKALGATVTAT  173 (320)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            46789999999999875


No 68 
>PRK07122 RNA polymerase sigma factor SigF; Reviewed
Probab=22.09  E-value=35  Score=25.64  Aligned_cols=26  Identities=19%  Similarity=0.128  Sum_probs=20.2

Q ss_pred             CchhhhhhhhhhcceEEecchhhhhhc
Q 045775            2 NATYIISIARKLGCSIFLLPEDITEVN   28 (87)
Q Consensus         2 NAkyaISiARKlGa~IfllpEDIveVk   28 (87)
                      |..++.++|+|+-.. .+-.+||+++-
T Consensus        49 ~l~LV~~iA~~y~~~-g~~~~DLiQeG   74 (264)
T PRK07122         49 CLPLADHIARRFDGR-GEPRDDLVQVA   74 (264)
T ss_pred             hHHHHHHHHHHHHhC-CCCHHHHHHHH
Confidence            678999999998554 45688998764


No 69 
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone  + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH
Probab=21.59  E-value=61  Score=23.10  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=13.9

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ..++.+||.+|+.||++
T Consensus       161 ~~~~~~a~~~g~~v~~~  177 (326)
T cd08289         161 SLAVSILAKLGYEVVAS  177 (326)
T ss_pred             HHHHHHHHHCCCeEEEE
Confidence            46788999999998864


No 70 
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catal
Probab=21.44  E-value=67  Score=23.52  Aligned_cols=17  Identities=18%  Similarity=0.315  Sum_probs=14.7

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+||.+|+.|+++
T Consensus       177 ~~~~~~a~~~G~~vi~~  193 (333)
T cd08296         177 HLAVQYAAKMGFRTVAI  193 (333)
T ss_pred             HHHHHHHHHCCCeEEEE
Confidence            57889999999998876


No 71 
>PRK12415 fructose 1,6-bisphosphatase II; Reviewed
Probab=21.22  E-value=67  Score=26.52  Aligned_cols=21  Identities=29%  Similarity=0.415  Sum_probs=17.9

Q ss_pred             hhhhhhhhhcceEEecch-hhh
Q 045775            5 YIISIARKLGCSIFLLPE-DIT   25 (87)
Q Consensus         5 yaISiARKlGa~IfllpE-DIv   25 (87)
                      ..|.-.|+.||+|.|+++ ||.
T Consensus       169 ~lI~eir~~Gari~Li~DGDV~  190 (322)
T PRK12415        169 DIIDRVRAKGARVKLFGDGDVG  190 (322)
T ss_pred             HHHHHHHHcCCeEEEeccccHH
Confidence            357778999999999999 873


No 72 
>PF15240 Pro-rich:  Proline-rich
Probab=20.89  E-value=96  Score=23.66  Aligned_cols=21  Identities=14%  Similarity=0.354  Sum_probs=14.8

Q ss_pred             hhHHHHHHHHHHhhcCCcccc
Q 045775           31 MILTLTASIMHWFMKQPVEEK   51 (87)
Q Consensus        31 MimT~~AsLM~~~~~~~~~~~   51 (87)
                      +|++|.|.|++++-.+..++-
T Consensus         2 LlVLLSvALLALSSAQ~~dEd   22 (179)
T PF15240_consen    2 LLVLLSVALLALSSAQSTDED   22 (179)
T ss_pred             hhHHHHHHHHHhhhccccccc
Confidence            355566899999887765443


No 73 
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reducta
Probab=20.82  E-value=65  Score=23.12  Aligned_cols=17  Identities=18%  Similarity=0.256  Sum_probs=14.4

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+|+++|+.|+++
T Consensus       169 ~~~~q~a~~~G~~vi~~  185 (319)
T cd08242         169 LLIAQVLALTGPDVVLV  185 (319)
T ss_pred             HHHHHHHHHcCCeEEEE
Confidence            46789999999998876


No 74 
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]
Probab=20.58  E-value=61  Score=27.22  Aligned_cols=15  Identities=20%  Similarity=0.377  Sum_probs=13.2

Q ss_pred             hhhhhhhhcceEEec
Q 045775            6 IISIARKLGCSIFLL   20 (87)
Q Consensus         6 aISiARKlGa~Ifll   20 (87)
                      .|.+|||+||++|.-
T Consensus       206 Rle~Ak~~Ga~~~~~  220 (354)
T KOG0024|consen  206 RLELAKKFGATVTDP  220 (354)
T ss_pred             HHHHHHHhCCeEEee
Confidence            578999999999975


No 75 
>cd05288 PGDH Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino 
Probab=20.44  E-value=68  Score=22.88  Aligned_cols=17  Identities=24%  Similarity=0.368  Sum_probs=14.4

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      .+++.+||+.|+.|+.+
T Consensus       160 ~~~~~~a~~~G~~vi~~  176 (329)
T cd05288         160 SVVGQIAKLLGARVVGI  176 (329)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            56789999999998876


No 76 
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=20.28  E-value=70  Score=22.31  Aligned_cols=17  Identities=29%  Similarity=0.550  Sum_probs=14.8

Q ss_pred             hhhhhhhhhhcceEEec
Q 045775            4 TYIISIARKLGCSIFLL   20 (87)
Q Consensus         4 kyaISiARKlGa~Ifll   20 (87)
                      ..++.+||.+|+.||.+
T Consensus       158 ~~~~~la~~~g~~v~~~  174 (319)
T cd08267         158 TFAVQIAKALGAHVTGV  174 (319)
T ss_pred             HHHHHHHHHcCCEEEEE
Confidence            46789999999999986


No 77 
>PF07905 PucR:  Purine catabolism regulatory protein-like family;  InterPro: IPR012914 This domain is found in the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR, O32138 from SWISSPROT). PucR is thought to be a transcriptional regulator of genes involved in the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression []. The other members of this family are also putative regulatory proteins. 
Probab=20.16  E-value=69  Score=21.30  Aligned_cols=21  Identities=29%  Similarity=0.539  Sum_probs=18.0

Q ss_pred             hhhhhhhhhhcceEEecchhh
Q 045775            4 TYIISIARKLGCSIFLLPEDI   24 (87)
Q Consensus         4 kyaISiARKlGa~IfllpEDI   24 (87)
                      +.+|..|+++|--+|.+|.++
T Consensus        89 ~~~i~~A~~~~lPli~ip~~~  109 (123)
T PF07905_consen   89 EEIIELADELGLPLIEIPWEV  109 (123)
T ss_pred             HHHHHHHHHcCCCEEEeCCCC
Confidence            457889999999999999864


No 78 
>cd05285 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=20.15  E-value=63  Score=23.70  Aligned_cols=18  Identities=11%  Similarity=0.390  Sum_probs=15.0

Q ss_pred             chhhhhhhhhhcce-EEec
Q 045775            3 ATYIISIARKLGCS-IFLL   20 (87)
Q Consensus         3 AkyaISiARKlGa~-Ifll   20 (87)
                      ...++.+||++|+. ||++
T Consensus       175 G~~a~~lak~~G~~~v~~~  193 (343)
T cd05285         175 GLLTAAVAKAFGATKVVVT  193 (343)
T ss_pred             HHHHHHHHHHcCCcEEEEE
Confidence            35789999999998 8776


No 79 
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=20.08  E-value=66  Score=24.91  Aligned_cols=15  Identities=27%  Similarity=0.578  Sum_probs=10.8

Q ss_pred             hhhhhhhhhhcceEE
Q 045775            4 TYIISIARKLGCSIF   18 (87)
Q Consensus         4 kyaISiARKlGa~If   18 (87)
                      .++|++|+++|+++.
T Consensus       157 ~~aiQlAk~~G~~~v  171 (326)
T COG0604         157 SAAIQLAKALGATVV  171 (326)
T ss_pred             HHHHHHHHHcCCcEE
Confidence            468888888885543


No 80 
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism]
Probab=20.08  E-value=35  Score=29.57  Aligned_cols=28  Identities=32%  Similarity=0.440  Sum_probs=25.4

Q ss_pred             hhhhhhcceEEecchhhhhhchhhhHHH
Q 045775            8 SIARKLGCSIFLLPEDITEVNQKMILTL   35 (87)
Q Consensus         8 SiARKlGa~IfllpEDIveVk~KMimT~   35 (87)
                      |.|+|+|+.-|-++-|+||-.|..|+.-
T Consensus        88 saa~~yg~~~ft~lhdlcerhpDvvLlc  115 (480)
T KOG2380|consen   88 SAAEKYGSAKFTLLHDLCERHPDVVLLC  115 (480)
T ss_pred             HHHHHhcccccccHHHHHhcCCCEEEEE
Confidence            6899999999999999999999988753


No 81 
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=20.05  E-value=71  Score=23.17  Aligned_cols=18  Identities=11%  Similarity=0.305  Sum_probs=15.5

Q ss_pred             chhhhhhhhhhcceEEec
Q 045775            3 ATYIISIARKLGCSIFLL   20 (87)
Q Consensus         3 AkyaISiARKlGa~Ifll   20 (87)
                      ..+++.+||.+|+.||++
T Consensus       179 g~~~~~~a~~~g~~v~~~  196 (341)
T cd08297         179 GHLGVQYAKAMGLRVIAI  196 (341)
T ss_pred             HHHHHHHHHHCCCeEEEE
Confidence            357899999999999886


Done!