Citrus Sinensis ID: 045788


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MSQVADFFVLVVPERVRVAVRLWPRNAEETVVDADFADCVELQIELKRLKLRKNNWNSDTYEFDEVFTEFVSQKRVYEVVAKPVVEQQQQQQQWQRSWRRGKIKWPISLLV
cccccHHHHccccccEEEEEEEcccccHHHHcccccccEEEEEccccEEEEcccccccccEEccEEccccccHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccc
****ADFFVLVVPERVRVAVRLWPRNAEETVVDADFADCVELQIELKRLKLRKNNWNSDTYEFDEVFTEFVSQKRVYEVVAKPVVEQQQ**********RGKIKWPISLLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQVADFFVLVVPERVRVAVRLWPRNAEETVVDADFADxxxxxxxxxxxxxxxxxxxxxTYEFDEVFTEFVSQKRVYEVVAKPVVEQQQQQQQWQRSWRRGKIKWPISLLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Armadillo repeat-containing kinesin-like protein 2 probableQ5VQ09
Armadillo repeat-containing kinesin-like protein 2 Involved in the control of epidermal-cell morphogenesis in roots and helical growth of roots by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules. Seems to be involved in the control of cell-file rotation (or twisting).probableQ9LPC6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B6U, chain A
Confidence level:very confident
Coverage over the Query: 24-94
View the alignment between query and template
View the model in PyMOL