BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045900
         (155 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NGV|A Chain A, Crystal Structure Of Anst-D7l1
 pdb|3NHI|A Chain A, Crystal Structure Of The Anst-D7l1-Leukotriene C4 Complex
 pdb|3NHT|A Chain A, Crystal Structure Of The Anst-D7l1-U46619 Complex
          Length = 296

 Score = 28.9 bits (63), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 72  LTDPMRKEVAVVRKKIDMANRELKPLGQSIQKKEREYKEALEAFNEKSKEKAQLVTALME 131
           + DP  +E A    +I +  +  K + QS QK+  EY++AL A N KS     L  A + 
Sbjct: 61  IYDP--QENAFKSDRIPVQYQAYKTITQSKQKEVTEYQKALAAANAKSGSCVDLYNAYLP 118

Query: 132 L 132
           +
Sbjct: 119 V 119


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.125    0.311 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,811,262
Number of Sequences: 62578
Number of extensions: 83953
Number of successful extensions: 503
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 35
Number of HSP's that attempted gapping in prelim test: 479
Number of HSP's gapped (non-prelim): 60
length of query: 155
length of database: 14,973,337
effective HSP length: 91
effective length of query: 64
effective length of database: 9,278,739
effective search space: 593839296
effective search space used: 593839296
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 47 (22.7 bits)