BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045952
         (569 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From
           Methanosarcina Acetivorans Containing A Link Between
           Lys256 And Cys298
 pdb|3ETC|B Chain B, 2.1 A Structure Of Acyl-Adenylate Synthetase From
           Methanosarcina Acetivorans Containing A Link Between
           Lys256 And Cys298
          Length = 580

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

Query: 400 HFTLRICNFTGELWSIYFSQHSGGKWVAAYDLEYIEGNKAIVYSSKNGHASFPHPGTYLQ 459
           H+T+    +   +W   + Q   G  V  YD +  E    +  +SK G  +F  P T   
Sbjct: 269 HYTVADSGWGKCVWGKLYGQWIAGCAVFVYDYDRFEAKNMLEKASKYGVTTFCAPPT--- 325

Query: 460 GSEILGIGVRNDAARSNLYVDSSIQYELVAAEYLGEGV---VAEPSWLQFMRKWGPT 513
              I    ++ D +  N    S+++Y +VA E L   V     E + ++ M  +G T
Sbjct: 326 ---IYRFLIKEDLSHYNF---STLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQT 376


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.139    0.452 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,993,936
Number of Sequences: 62578
Number of extensions: 925551
Number of successful extensions: 1981
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1980
Number of HSP's gapped (non-prelim): 3
length of query: 569
length of database: 14,973,337
effective HSP length: 104
effective length of query: 465
effective length of database: 8,465,225
effective search space: 3936329625
effective search space used: 3936329625
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)