BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045953
         (129 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZDI|A Chain A, Crystal Structure Of Prefoldin From Pyrococcus
          Horikoshii Ot3
 pdb|2ZDI|B Chain B, Crystal Structure Of Prefoldin From Pyrococcus
          Horikoshii Ot3
          Length = 117

 Score = 28.9 bits (63), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 45 LEELRQLPDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAAL 91
          LEE+  LPD+   YK++G   V   K   + E +++++  E  + AL
Sbjct: 43 LEEIETLPDDAQIYKTVGTLIVKTTKEKAVQELKEKIETLEVRLNAL 89


>pdb|2ZQM|A Chain A, Crystal Structure Of The Prefoldin Beta Subunit From
          Thermococcus Strain Ks-1
          Length = 117

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 45 LEELRQLPDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQ 92
          L+E+  LPD+   YK++G   V   K   + E +++++  E  + AL+
Sbjct: 43 LDEIESLPDDAVVYKTVGTLIVKTTKDKAVAELKEKIETLEVRLNALE 90


>pdb|2PMP|A Chain A, Structure Of 2c-Methyl-D-Erythritol 2,4-Cyclodiphosphate
           Synthase From The Isoprenoid Biosynthetic Pathway Of
           Arabidopsis Thaliana
          Length = 160

 Score = 26.9 bits (58), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 43  LTLEELRQL-PDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQASKEYLEKQ 101
           L L ++ Q+ PD+   +K    +  ++    LM+E    + + +   A L   +  +   
Sbjct: 55  LGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLD---ATLILQRPKISPH 111

Query: 102 KAEVESNLAELLQQDP 117
           K  + SNL++LL  DP
Sbjct: 112 KETIRSNLSKLLGADP 127


>pdb|1P85|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P86|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AWB|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|1VS6|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS8|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2GYA|F Chain F, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYC|F Chain F, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
 pdb|2I2T|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2V|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2J28|H Chain H, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|2QOV|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
           The Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QOX|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QOZ|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAO|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBA|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBC|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBE|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBG|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBI|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The First 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBK|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The Second 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The First 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The Second 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2VHM|H Chain H, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 1 Of 4)
 pdb|2VHN|H Chain H, Structure Of Pdf Binding Helix In Complex With The
           Ribosome. (Part 2 Of 4)
 pdb|2RDO|H Chain H, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|3DF2|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The First 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3DF4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The Second 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3BBX|H Chain H, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
           Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3FIK|H Chain H, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 50s Subunit.
 pdb|3E1B|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Pre-Accommodation State
 pdb|3E1D|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Post-Accommodation State
 pdb|3I1N|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1P|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1R|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1T|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I20|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I22|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KCR|H Chain H, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 pdb|2WWQ|H Chain H, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 50s, The P-Site
           Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|1VT2|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3ORB|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 pdb|3OFQ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFR|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFZ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAS|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAT|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Telithromycin Bound.
 pdb|3IZT|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 pdb|3IZU|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 pdb|3J01|H Chain H, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|3R8S|H Chain H, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3R8T|H Chain H, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3J0T|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0W|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0Y|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J11|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 3 Of The Six
           Classes)
 pdb|3J12|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J14|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J19|H Chain H, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (50s Subunit)
 pdb|4GAR|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAU|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 149

 Score = 26.2 bits (56), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 15/79 (18%)

Query: 48  LRQLPDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQASKEYLEKQKAEVES 107
           L  L D  N      R F L P+                A+ A + + E+ E ++AE+E+
Sbjct: 12  LGSLGDQVNVKAGYARNF-LVPQG--------------KAVPATKKNIEFFEARRAELEA 56

Query: 108 NLAELLQQDPGLAQQIMSM 126
            LAE+L      A++I ++
Sbjct: 57  KLAEVLAAANARAEKINAL 75


>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk
 pdb|1Q12|B Chain B, Crystal Structure Of The Atp-bound E. Coli Malk
 pdb|1Q12|C Chain C, Crystal Structure Of The Atp-bound E. Coli Malk
 pdb|1Q12|D Chain D, Crystal Structure Of The Atp-bound E. Coli Malk
 pdb|1Q1E|A Chain A, The Atpase Component Of E. Coli Maltose Transporter (Malk)
           In The Nucleotide-Free Form
 pdb|1Q1E|B Chain B, The Atpase Component Of E. Coli Maltose Transporter (Malk)
           In The Nucleotide-Free Form
 pdb|2AWN|A Chain A, Crystal Structure Of The Adp-Mg-Bound E. Coli Malk
           (Crystallized With Atp-Mg)
 pdb|2AWN|B Chain B, Crystal Structure Of The Adp-Mg-Bound E. Coli Malk
           (Crystallized With Atp-Mg)
 pdb|2AWN|C Chain C, Crystal Structure Of The Adp-Mg-Bound E. Coli Malk
           (Crystallized With Atp-Mg)
 pdb|2AWN|D Chain D, Crystal Structure Of The Adp-Mg-Bound E. Coli Malk
           (Crystallized With Atp-Mg)
 pdb|2AWO|A Chain A, Crystal Structure Of The Adp-mg-bound E. Coli Malk
           (crystallized With Adp-mg)
 pdb|2AWO|B Chain B, Crystal Structure Of The Adp-mg-bound E. Coli Malk
           (crystallized With Adp-mg)
 pdb|2AWO|C Chain C, Crystal Structure Of The Adp-mg-bound E. Coli Malk
           (crystallized With Adp-mg)
 pdb|2AWO|D Chain D, Crystal Structure Of The Adp-mg-bound E. Coli Malk
           (crystallized With Adp-mg)
 pdb|3FH6|A Chain A, Crystal Structure Of The Resting State Maltose Transporter
           From E. Coli
 pdb|3FH6|B Chain B, Crystal Structure Of The Resting State Maltose Transporter
           From E. Coli
 pdb|3FH6|C Chain C, Crystal Structure Of The Resting State Maltose Transporter
           From E. Coli
 pdb|3FH6|D Chain D, Crystal Structure Of The Resting State Maltose Transporter
           From E. Coli
 pdb|3PUY|A Chain A, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Amp-Pnp After Crystal
           Soaking Of The Pretranslocation State
 pdb|3PUY|B Chain B, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Amp-Pnp After Crystal
           Soaking Of The Pretranslocation State
 pdb|3PUZ|A Chain A, Crystal Structure Of A Pre-Translocation State Mbp-Maltose
           Transporter Complex Bound To Amp-Pnp
 pdb|3PUZ|B Chain B, Crystal Structure Of A Pre-Translocation State Mbp-Maltose
           Transporter Complex Bound To Amp-Pnp
 pdb|3PV0|A Chain A, Crystal Structure Of A Pre-Translocation State Mbp-Maltose
           Transporter Complex Without Nucleotide
 pdb|3PV0|B Chain B, Crystal Structure Of A Pre-Translocation State Mbp-Maltose
           Transporter Complex Without Nucleotide
 pdb|3PUV|A Chain A, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Vo4
 pdb|3PUV|B Chain B, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Vo4
 pdb|3PUW|A Chain A, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Alf4
 pdb|3PUW|B Chain B, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Alf4
 pdb|3PUX|A Chain A, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Bef3
 pdb|3PUX|B Chain B, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Bef3
 pdb|3RLF|A Chain A, Crystal Structure Of The Maltose-Binding ProteinMALTOSE
           TRANSPORTER Complex In An Outward-Facing Conformation
           Bound To Mgamppnp
 pdb|3RLF|B Chain B, Crystal Structure Of The Maltose-Binding ProteinMALTOSE
           TRANSPORTER Complex In An Outward-Facing Conformation
           Bound To Mgamppnp
          Length = 381

 Score = 26.2 bits (56), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 22  GKMKQVQNQMRNKEGEK-KRAYLTLEELRQLPDNTNTYKSIGRTFVLEPKSVLMNE 76
           G  K+V NQ  N+  E  + A+L   + + L        +IGRT V EP   L++E
Sbjct: 104 GAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDE 159


>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free
           Form
 pdb|1Q1B|B Chain B, Crystal Structure Of E. Coli Malk In The Nucleotide-Free
           Form
 pdb|1Q1B|C Chain C, Crystal Structure Of E. Coli Malk In The Nucleotide-Free
           Form
 pdb|1Q1B|D Chain D, Crystal Structure Of E. Coli Malk In The Nucleotide-Free
           Form
          Length = 381

 Score = 26.2 bits (56), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 22  GKMKQVQNQMRNKEGEK-KRAYLTLEELRQLPDNTNTYKSIGRTFVLEPKSVLMNE 76
           G  K+V NQ  N+  E  + A+L   + + L        +IGRT V EP   L++E
Sbjct: 104 GAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDE 159


>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish
           Tlr5 In Complex With Salmonella Flagellin
 pdb|3V47|B Chain B, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish
           Tlr5 In Complex With Salmonella Flagellin
          Length = 455

 Score = 25.8 bits (55), Expect = 5.9,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 13  IKGRMIENTGKMKQVQNQMRNKEGEKKRAYLTLEELRQLPDNTNTYKSI 61
           I  RM EN  K++ +     +      +++L L  L++L  +TN  KS+
Sbjct: 338 IDSRMFENLDKLEVLDLSYNHIRALGDQSFLGLPNLKELALDTNQLKSV 386


>pdb|1FXK|B Chain B, Crystal Structure Of Archaeal Prefoldin (gimc)
          Length = 109

 Score = 25.8 bits (55), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 45  LEELRQLPDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQASKEYLEKQKAE 104
           LEEL +  D+   YKS G   +   K  L  E +++L+        LQ  ++ +E+Q+  
Sbjct: 37  LEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLE-------TLQLREKTIERQEER 89

Query: 105 VESNLAE 111
           V   L E
Sbjct: 90  VXKKLQE 96


>pdb|2XZM|4 Chain 4, Crystal Structure Of The Eukaryotic 40s Ribosomal
          Subunit In Complex With Initiation Factor 1. This File
          Contains The 40s Subunit And Initiation Factor For
          Molecule 1
 pdb|2XZN|4 Chain 4, Crystal Structure Of The Eukaryotic 40s Ribosomal
          Subunit In Complex With Initiation Factor 1. This File
          Contains The 40s Subunit And Initiation Factor For
          Molecule 2
          Length = 265

 Score = 25.4 bits (54), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 14/17 (82%)

Query: 5  ANRAAFQEIKGRMIENT 21
           NR A +EIKGR++E+T
Sbjct: 55 GNRIASEEIKGRVVEST 71


>pdb|1FXK|A Chain A, Crystal Structure Of Archaeal Prefoldin (gimc)
          Length = 107

 Score = 25.4 bits (54), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 45  LEELRQLPDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQASKEYLEKQKAE 104
           LEEL +  D+   YKS G   +   K  L  E +++L+        LQ  ++ +E+Q+  
Sbjct: 38  LEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLE-------TLQLREKTIERQEER 90

Query: 105 VESNLAE 111
           V   L E
Sbjct: 91  VXKKLQE 97


>pdb|1V9D|A Chain A, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1
 pdb|1V9D|B Chain B, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1
 pdb|1V9D|C Chain C, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1
 pdb|1V9D|D Chain D, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1
          Length = 340

 Score = 25.4 bits (54), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 48  LRQLPDNTNT-YKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQASKE 96
           LR +  N  T YK +G  FV +PK + + E    L +  +    LQA KE
Sbjct: 264 LRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMF--LQAVKE 311


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.307    0.122    0.308 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,082,009
Number of Sequences: 62578
Number of extensions: 104565
Number of successful extensions: 357
Number of sequences better than 100.0: 49
Number of HSP's better than 100.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 17
Number of HSP's that attempted gapping in prelim test: 316
Number of HSP's gapped (non-prelim): 56
length of query: 129
length of database: 14,973,337
effective HSP length: 88
effective length of query: 41
effective length of database: 9,466,473
effective search space: 388125393
effective search space used: 388125393
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 45 (21.9 bits)