BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045965
         (140 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal
           Structure Of Polyamine Oxidase
 pdb|1B37|B Chain B, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal
           Structure Of Polyamine Oxidase
 pdb|1B37|C Chain C, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal
           Structure Of Polyamine Oxidase
 pdb|1B5Q|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal
           Structure Of Polyamine Oxidase
 pdb|1B5Q|B Chain B, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal
           Structure Of Polyamine Oxidase
 pdb|1B5Q|C Chain C, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal
           Structure Of Polyamine Oxidase
 pdb|1H81|A Chain A, Structure Of Polyamine Oxidase In The Reduced State
 pdb|1H81|B Chain B, Structure Of Polyamine Oxidase In The Reduced State
 pdb|1H81|C Chain C, Structure Of Polyamine Oxidase In The Reduced State
 pdb|1H82|A Chain A, Structure Of Polyamine Oxidase In Complex With Guazatine
 pdb|1H82|B Chain B, Structure Of Polyamine Oxidase In Complex With Guazatine
 pdb|1H82|C Chain C, Structure Of Polyamine Oxidase In Complex With Guazatine
 pdb|1H83|A Chain A, Structure Of Polyamine Oxidase In Complex With 1,8-
           Diaminooctane
 pdb|1H83|B Chain B, Structure Of Polyamine Oxidase In Complex With 1,8-
           Diaminooctane
 pdb|1H83|C Chain C, Structure Of Polyamine Oxidase In Complex With 1,8-
           Diaminooctane
 pdb|1H84|A Chain A, Covalent Adduct Between Polyamine Oxidase And N1ethyln11
           ((Cycloheptyl)methyl)4,8diazaundecane At Ph 4.6
 pdb|1H84|B Chain B, Covalent Adduct Between Polyamine Oxidase And N1ethyln11
           ((Cycloheptyl)methyl)4,8diazaundecane At Ph 4.6
 pdb|1H84|C Chain C, Covalent Adduct Between Polyamine Oxidase And N1ethyln11
           ((Cycloheptyl)methyl)4,8diazaundecane At Ph 4.6
 pdb|1H86|A Chain A, Covalent Adduct Between Polyamine Oxidase And N1ethyln11
           ((Cycloheptyl)methyl)4,8diazaundecane At Ph 7.0
 pdb|1H86|B Chain B, Covalent Adduct Between Polyamine Oxidase And N1ethyln11
           ((Cycloheptyl)methyl)4,8diazaundecane At Ph 7.0
 pdb|1H86|C Chain C, Covalent Adduct Between Polyamine Oxidase And N1ethyln11
           ((Cycloheptyl)methyl)4,8diazaundecane At Ph 7.0
          Length = 472

 Score = 27.3 bits (59), Expect = 3.2,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 98  REKDFSGIGINITGNDNAV--TDVVIFSASIGVM 129
           RE  +S  G+ +   DN+V   D V+ SAS+GV+
Sbjct: 238 REIKYSPGGVTVKTEDNSVYSADYVMVSASLGVL 271


>pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine
           Oxidase From Zea Mays
 pdb|3KPF|B Chain B, X-Ray Structure Of The Mutant Lys300met Of Polyamine
           Oxidase From Zea Mays
 pdb|3KU9|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine
           Oxidase From Zea Mays In Complex With Spermine
 pdb|3KU9|B Chain B, X-Ray Structure Of The Mutant Lys300met Of Polyamine
           Oxidase From Zea Mays In Complex With Spermine
 pdb|3L1R|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine
           Oxidase From Zea Mays In Complex With Spermidine
 pdb|3L1R|B Chain B, X-Ray Structure Of The Mutant Lys300met Of Polyamine
           Oxidase From Zea Mays In Complex With Spermidine
          Length = 478

 Score = 27.3 bits (59), Expect = 3.2,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 98  REKDFSGIGINITGNDNAV--TDVVIFSASIGVM 129
           RE  +S  G+ +   DN+V   D V+ SAS+GV+
Sbjct: 238 REIKYSPGGVTVKTEDNSVYSADYVMVSASLGVL 271


>pdb|2IKQ|A Chain A, Crystal Structure Of Mouse Sts-1 Pgm Domain In Complex
           With Phosphate
 pdb|2IKQ|B Chain B, Crystal Structure Of Mouse Sts-1 Pgm Domain In Complex
           With Phosphate
 pdb|2IKQ|M Chain M, Crystal Structure Of Mouse Sts-1 Pgm Domain In Complex
           With Phosphate
          Length = 270

 Score = 27.3 bits (59), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 58  TVDNCYISHFTTAGISIQDGHETYIRNSF 86
           +VD  Y  H   + ++I + ++TYI  SF
Sbjct: 147 SVDTTYRPHIPVSKLAISESYDTYINRSF 175


>pdb|3MBK|A Chain A, The 1.35 A Structure Of The Phosphatase Domain Of The
           Suppressor Of T Cell Receptor Signalling Protein In
           Complex With Sulphate
 pdb|3MBK|B Chain B, The 1.35 A Structure Of The Phosphatase Domain Of The
           Suppressor Of T Cell Receptor Signalling Protein In
           Complex With Sulphate
          Length = 264

 Score = 26.9 bits (58), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 58  TVDNCYISHFTTAGISIQDGHETYIRNSF 86
           +VD  Y  H   + ++I + ++TYI  SF
Sbjct: 143 SVDTTYRPHIPVSKLAISESYDTYINRSF 171


>pdb|2H0Q|A Chain A, Crystal Structure Of The Pgm Domain Of The Suppressor Of
           T-Cell Receptor (Sts-1)
 pdb|2H0Q|B Chain B, Crystal Structure Of The Pgm Domain Of The Suppressor Of
           T-Cell Receptor (Sts-1)
 pdb|2H0Q|C Chain C, Crystal Structure Of The Pgm Domain Of The Suppressor Of
           T-Cell Receptor (Sts-1)
          Length = 261

 Score = 26.9 bits (58), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 58  TVDNCYISHFTTAGISIQDGHETYIRNSF 86
           +VD  Y  H   + ++I + ++TYI  SF
Sbjct: 143 SVDTTYRPHIPVSKLAISESYDTYINRSF 171


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.140    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,991,541
Number of Sequences: 62578
Number of extensions: 154473
Number of successful extensions: 314
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 306
Number of HSP's gapped (non-prelim): 13
length of query: 140
length of database: 14,973,337
effective HSP length: 89
effective length of query: 51
effective length of database: 9,403,895
effective search space: 479598645
effective search space used: 479598645
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 46 (22.3 bits)