Query         046002
Match_columns 160
No_of_seqs    129 out of 498
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:42:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046002.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046002hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02309 AUX_IAA:  AUX/IAA fami 100.0 1.8E-43 3.9E-48  289.0   0.3  114   44-160    86-203 (215)
  2 PF00564 PB1:  PB1 domain;  Int  97.7 0.00015 3.3E-09   50.0   7.0   66   72-155     4-70  (84)
  3 cd05992 PB1 The PB1 domain is   97.4   0.001 2.2E-08   45.6   7.4   65   72-155     3-69  (81)
  4 smart00666 PB1 PB1 domain. Pho  97.4   0.001 2.2E-08   45.9   7.4   65   72-155     4-69  (81)
  5 cd06398 PB1_Joka2 The PB1 doma  97.3  0.0013 2.8E-08   48.5   7.4   58   72-145     3-63  (91)
  6 cd06407 PB1_NLP A PB1 domain i  97.3  0.0013 2.8E-08   47.5   7.0   53   72-142     3-55  (82)
  7 cd06396 PB1_NBR1 The PB1 domai  96.8   0.007 1.5E-07   44.2   7.0   53   72-143     3-55  (81)
  8 cd06409 PB1_MUG70 The MUG70 pr  96.6  0.0049 1.1E-07   45.4   5.4   50   80-143     8-59  (86)
  9 cd06403 PB1_Par6 The PB1 domai  96.5  0.0098 2.1E-07   43.6   6.0   68   72-156     3-71  (80)
 10 cd06401 PB1_TFG The PB1 domain  96.2   0.041 8.9E-07   40.3   7.9   72   72-159     3-78  (81)
 11 cd06402 PB1_p62 The PB1 domain  96.0   0.039 8.4E-07   40.7   7.2   58   71-144     2-64  (87)
 12 cd06404 PB1_aPKC PB1 domain is  95.9   0.037 8.1E-07   40.7   6.4   54   72-143     3-56  (83)
 13 cd06397 PB1_UP1 Uncharacterize  95.4   0.065 1.4E-06   39.5   6.1   63   72-153     3-66  (82)
 14 cd06408 PB1_NoxR The PB1 domai  93.0    0.42   9E-06   35.3   6.2   53   71-144     4-56  (86)
 15 cd06399 PB1_P40 The PB1 domain  84.9     1.7 3.6E-05   32.7   4.1   43   81-142    18-60  (92)
 16 cd06395 PB1_Map2k5 PB1 domain   62.8      15 0.00032   27.5   4.1   49   77-143     9-57  (91)
 17 PF10411 DsbC_N:  Disulfide bon  52.4      13 0.00028   24.7   2.1   17  129-145    34-50  (57)
 18 cd06406 PB1_P67 A PB1 domain i  49.5      73  0.0016   23.3   5.8   65   71-155     4-69  (80)
 19 PF00788 RA:  Ras association (  39.1      85  0.0018   21.2   4.7   68   70-152     3-76  (93)
 20 PF09840 DUF2067:  Uncharacteri  34.1      26 0.00056   29.0   1.7   29  125-157    97-125 (190)
 21 PF14688 DUF4461:  Domain of un  33.9      29 0.00064   30.6   2.1   30  126-155    80-117 (313)
 22 PF09277 Erythro-docking:  Eryt  29.8      22 0.00048   24.6   0.5   16   14-29     33-48  (58)
 23 PRK13361 molybdenum cofactor b  27.8   2E+02  0.0043   24.8   6.1   75   74-159   187-263 (329)
 24 COG3286 Uncharacterized protei  27.4      37 0.00081   28.9   1.6   29  125-157   100-128 (204)
 25 PF12108 SF3a60_bindingd:  Spli  27.4      12 0.00026   22.4  -1.0   18  141-158     3-20  (28)
 26 PF13665 DUF4150:  Domain of un  27.3      46   0.001   25.2   1.9   23   71-93     83-105 (110)
 27 PF07929 PRiA4_ORF3:  Plasmid p  27.1      87  0.0019   24.6   3.5   38   71-108     6-45  (179)
 28 PF06463 Mob_synth_C:  Molybden  26.7 1.5E+02  0.0034   22.5   4.8   64   85-159    17-80  (128)
 29 cd04052 C2B_Tricalbin-like C2   26.0      87  0.0019   22.4   3.1   26   59-84      4-29  (111)
 30 PF07521 RMMBL:  RNA-metabolisi  24.2      81  0.0018   19.6   2.3   21   83-103    10-30  (43)
 31 COG0219 CspR Predicted rRNA me  23.7      34 0.00073   27.9   0.6   55   77-146    48-105 (155)
 32 PF02013 CBM_10:  Cellulose or   23.5      24 0.00051   22.2  -0.3   12  129-140    16-27  (36)
 33 PF09676 TraV:  Type IV conjuga  22.7      57  0.0012   24.0   1.6   19  127-145    92-110 (119)
 34 PF04566 RNA_pol_Rpb2_4:  RNA p  21.6 1.1E+02  0.0024   20.9   2.8   27   74-106     1-27  (63)
 35 PF04809 HupH_C:  HupH hydrogen  21.1      84  0.0018   24.1   2.3   31  127-157    72-112 (120)
 36 PRK11430 putative CoA-transfer  20.6      94   0.002   27.8   2.9   26  130-156   240-268 (381)

No 1  
>PF02309 AUX_IAA:  AUX/IAA family;  InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression []. The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.
Probab=100.00  E-value=1.8e-43  Score=289.01  Aligned_cols=114  Identities=27%  Similarity=0.422  Sum_probs=4.7

Q ss_pred             ccCCCCCCCcCCCCCCCCCCCCCCCCCceEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccc-c---cccccccc
Q 046002           44 LVNNPNNNRLQAFPGLDDDDLVSTVVPPVTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEA-A---AINSEQDL  119 (160)
Q Consensus        44 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~-~---~~~~~~~l  119 (160)
                      .++||+.++++...+.  +..++..++||||+|||+||||||||++|+||++|+.+|++||.+.... +   +....+.+
T Consensus        86 ~vgwpp~~s~r~n~~~--~~~~~~~~~~vKV~mdG~~igRkVDL~~~~sY~~L~~~L~~MF~~~~i~~~~~~~~~~~~~~  163 (215)
T PF02309_consen   86 VVGWPPVRSFRKNSLS--EKQSSSSRSYVKVNMDGVPIGRKVDLSAYSSYEELSSALEKMFSCFSIEQCGSHGLNESGLL  163 (215)
T ss_dssp             BTTBS----S----------------------------------------------------------------------
T ss_pred             ccCCCccccccccccc--ccccccCCceeEEEecCcccceecCHHHhhCHHHHHHHHHHhcCCCCccccccccccchhhc
Confidence            4599999998875444  2333446999999999999999999999999999999999999554321 0   11122334


Q ss_pred             ccCCCCCCcEEEEEcCCCCeEEcCCcChHHHHhccceeEeC
Q 046002          120 DLSNAVPGHLIAYEDMENDLLLAGDLNWKDFVRVLREFGYC  160 (160)
Q Consensus       120 dl~~~~~~~~l~YeD~EGD~MLVGDvPW~~Fv~sVKRLrI~  160 (160)
                      +|.+ .++|+|||||+||||||||||||+|||++||||+|+
T Consensus       164 ~~~~-~~~~~l~Y~D~egd~mlvGD~PW~~F~~~vkRl~I~  203 (215)
T PF02309_consen  164 DLLN-GSEYVLVYEDKEGDWMLVGDVPWEEFVKSVKRLRIM  203 (215)
T ss_dssp             -----------------------------------------
T ss_pred             cccC-CcceeEEEECCCCCEEEecCCCHHHHHHHhhccEEe
Confidence            5555 459999999999999999999999999999999996


No 2  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=97.74  E-value=0.00015  Score=49.99  Aligned_cols=66  Identities=23%  Similarity=0.333  Sum_probs=54.9

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCC-cChHHH
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGD-LNWKDF  150 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGD-vPW~~F  150 (160)
                      +|+...|. +=|.+.+..--+|++|...+++.|+...                 ..+.|.|.|.||||..+.+ .=|++.
T Consensus         4 vK~~~~~~-~~~~~~~~~~~s~~~L~~~i~~~~~~~~-----------------~~~~l~Y~D~dgD~V~i~sd~Dl~~a   65 (84)
T PF00564_consen    4 VKVRYGGD-IRRIISLPSDVSFDDLRSKIREKFGLLD-----------------EDFQLKYKDEDGDLVTISSDEDLQEA   65 (84)
T ss_dssp             EEEEETTE-EEEEEEECSTSHHHHHHHHHHHHHTTST-----------------SSEEEEEEETTSSEEEESSHHHHHHH
T ss_pred             EEEEECCe-eEEEEEcCCCCCHHHHHHHHHHHhCCCC-----------------ccEEEEeeCCCCCEEEeCCHHHHHHH
Confidence            78999995 4446888888899999999999999862                 2578999999999998874 558888


Q ss_pred             Hhccc
Q 046002          151 VRVLR  155 (160)
Q Consensus       151 v~sVK  155 (160)
                      +..++
T Consensus        66 ~~~~~   70 (84)
T PF00564_consen   66 IEQAK   70 (84)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            88875


No 3  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=97.42  E-value=0.001  Score=45.60  Aligned_cols=65  Identities=18%  Similarity=0.315  Sum_probs=52.0

Q ss_pred             eEEEEcCceeeeeeccC-CCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCC-cChHH
Q 046002           72 VTVVLEGRSICQRISLH-KHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGD-LNWKD  149 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~-~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGD-vPW~~  149 (160)
                      |||.-.|.  -|.+-+. ..-+|++|...|.+.|+...                 ..+.+.|.|.||||..+.+ .=|++
T Consensus         3 vK~~~~~~--~~~~~~~~~~~s~~~L~~~i~~~~~~~~-----------------~~~~l~y~D~e~d~v~l~sd~Dl~~   63 (81)
T cd05992           3 VKVKYGGE--IRRFVVVSRSISFEDLRSKIAEKFGLDA-----------------VSFKLKYPDEDGDLVTISSDEDLEE   63 (81)
T ss_pred             EEEEecCC--CEEEEEecCCCCHHHHHHHHHHHhCCCC-----------------CcEEEEeeCCCCCEEEeCCHHHHHH
Confidence            78888874  3445555 88999999999999998752                 2468999999999998887 77777


Q ss_pred             HHhccc
Q 046002          150 FVRVLR  155 (160)
Q Consensus       150 Fv~sVK  155 (160)
                      -++.++
T Consensus        64 a~~~~~   69 (81)
T cd05992          64 AIEEAR   69 (81)
T ss_pred             HHHHHh
Confidence            777765


No 4  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=97.41  E-value=0.001  Score=45.86  Aligned_cols=65  Identities=18%  Similarity=0.330  Sum_probs=52.1

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC-CcChHHH
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG-DLNWKDF  150 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG-DvPW~~F  150 (160)
                      |||.-.|  --|.+-+..--+|++|..++.+.|+...                 ..+.|.|+|.||||..+. |.=|++-
T Consensus         4 vK~~~~~--~~~~~~~~~~~s~~dL~~~i~~~~~~~~-----------------~~~~l~Y~Dedgd~v~l~sd~Dl~~a   64 (81)
T smart00666        4 VKLRYGG--ETRRLSVPRDISFEDLRSKVAKRFGLDN-----------------QSFTLKYQDEDGDLVSLTSDEDLEEA   64 (81)
T ss_pred             EEEEECC--EEEEEEECCCCCHHHHHHHHHHHhCCCC-----------------CCeEEEEECCCCCEEEecCHHHHHHH
Confidence            7888855  4677888889999999999999998642                 357899999999998665 4677777


Q ss_pred             Hhccc
Q 046002          151 VRVLR  155 (160)
Q Consensus       151 v~sVK  155 (160)
                      +..++
T Consensus        65 ~~~~~   69 (81)
T smart00666       65 IEEYD   69 (81)
T ss_pred             HHHHH
Confidence            77665


No 5  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=97.31  E-value=0.0013  Score=48.47  Aligned_cols=58  Identities=16%  Similarity=0.170  Sum_probs=46.4

Q ss_pred             eEEEEcCceeeeeeccC---CCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCCc
Q 046002           72 VTVVLEGRSICQRISLH---KHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGDL  145 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~---~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGDv  145 (160)
                      |||.-+|.-+==++++.   ..-+|++|...+++.|.+..                ..+++|.|.|.||||..+-.+
T Consensus         3 vKv~y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l~~----------------~~~~~l~Y~Dedgd~V~l~~D   63 (91)
T cd06398           3 VKVKYGGTLRRFTFPVAENQLDLNMDGLREKVEELFSLSP----------------DADLSLTYTDEDGDVVTLVDD   63 (91)
T ss_pred             EEEEeCCEEEEEEeccccccCCCCHHHHHHHHHHHhCCCC----------------CCcEEEEEECCCCCEEEEccH
Confidence            89999997544455553   46799999999999998753                247899999999999987654


No 6  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=97.28  E-value=0.0013  Score=47.46  Aligned_cols=53  Identities=15%  Similarity=0.221  Sum_probs=43.5

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEc
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLA  142 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLV  142 (160)
                      |||...|.  -+.+-|..--+|++|..++.++|....                ...+.|-|.|.||||.++
T Consensus         3 vK~~~~~d--~~r~~l~~~~~~~~L~~~i~~r~~~~~----------------~~~f~LkY~Ddegd~v~l   55 (82)
T cd06407           3 VKATYGEE--KIRFRLPPSWGFTELKQEIAKRFKLDD----------------MSAFDLKYLDDDEEWVLL   55 (82)
T ss_pred             EEEEeCCe--EEEEEcCCCCCHHHHHHHHHHHhCCCC----------------CCeeEEEEECCCCCeEEe
Confidence            89999886  445666666699999999999999742                246899999999999876


No 7  
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=96.79  E-value=0.007  Score=44.20  Aligned_cols=53  Identities=21%  Similarity=0.254  Sum_probs=46.1

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG  143 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG  143 (160)
                      |||.-.|.-+--+++-+..-+|++|..++.++|++.                   .+.|.|-|.||||.++-
T Consensus         3 vKaty~~d~~rf~~~~~~~~~~~~L~~ev~~rf~l~-------------------~f~lKYlDde~e~v~ls   55 (81)
T cd06396           3 LKVTYNGESQSFLVSDSENTTWASVEAMVKVSFGLN-------------------DIQIKYVDEENEEVSVN   55 (81)
T ss_pred             EEEEECCeEEEEEecCCCCCCHHHHHHHHHHHhCCC-------------------cceeEEEcCCCCEEEEE
Confidence            799999988877888877889999999999999986                   24689999999998763


No 8  
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=96.65  E-value=0.0049  Score=45.36  Aligned_cols=50  Identities=18%  Similarity=0.155  Sum_probs=38.7

Q ss_pred             eeeeee--ccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC
Q 046002           80 SICQRI--SLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG  143 (160)
Q Consensus        80 ~IGRKV--DL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG  143 (160)
                      |-||.+  -+....|+.+|..++.+-|+....              ....+.|.|.|.||||.++-
T Consensus         8 ~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~~--------------~~~~~~L~YlDDEgD~VllT   59 (86)
T cd06409           8 PKGRVHRFRLRPSESLEELRTLISQRLGDDDF--------------ETHLYALSYVDDEGDIVLIT   59 (86)
T ss_pred             CCCCEEEEEecCCCCHHHHHHHHHHHhCCccc--------------cCCcccEEEEcCCCCEEEEe
Confidence            456544  444578999999999999988653              13578999999999998764


No 9  
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=96.49  E-value=0.0098  Score=43.56  Aligned_cols=68  Identities=19%  Similarity=0.215  Sum_probs=49.6

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC-CcChHHH
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG-DLNWKDF  150 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG-DvPW~~F  150 (160)
                      ||..-+++=-=-.+|.....+|+++++-|+.|+.+..                 -.++|-|.|.+||++-+- |+-...=
T Consensus         3 VKSkfdaEfRRFsl~r~~~~~f~ef~~ll~~lH~l~~-----------------~~f~i~Y~D~~gDLLPInNDdNf~kA   65 (80)
T cd06403           3 VKSKFDAEFRRFSLDRNKPGKFEDFYKLLEHLHHIPN-----------------VDFLIGYTDPHGDLLPINNDDNFLKA   65 (80)
T ss_pred             eecccCCeEEEEEeccccCcCHHHHHHHHHHHhCCCC-----------------CcEEEEEeCCCCCEecccCcHHHHHH
Confidence            6666666432234555666999999999999999864                 258999999999999764 4555555


Q ss_pred             Hhccce
Q 046002          151 VRVLRE  156 (160)
Q Consensus       151 v~sVKR  156 (160)
                      +.+++.
T Consensus        66 lssa~p   71 (80)
T cd06403          66 LSSANP   71 (80)
T ss_pred             HHcCCC
Confidence            555554


No 10 
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=96.18  E-value=0.041  Score=40.33  Aligned_cols=72  Identities=21%  Similarity=0.320  Sum_probs=50.3

Q ss_pred             eEEEEcCceeeeeeccCCC-CCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCCc---Ch
Q 046002           72 VTVVLEGRSICQRISLHKH-ASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGDL---NW  147 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~-~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGDv---PW  147 (160)
                      +|+.-+| .| |++-+..- -+|.+|...+++.|...-.              ....+.|.|.|.|||+.-+.+.   -|
T Consensus         3 iK~~~g~-Di-R~~~~~~~~~t~~~L~~~v~~~F~~~~~--------------~~~~flIKYkD~dGDlVTIts~~dL~~   66 (81)
T cd06401           3 LKAQLGD-DI-RRIPIHNEDITYDELLLMMQRVFRGKLG--------------SSDDVLIKYKDEDGDLITIFDSSDLSF   66 (81)
T ss_pred             EEEEeCC-eE-EEEeccCccccHHHHHHHHHHHhccccC--------------CcccEEEEEECCCCCEEEeccHHHHHH
Confidence            6777766 45 44555543 3999999999999996421              1457899999999999999873   34


Q ss_pred             HHHHhccceeEe
Q 046002          148 KDFVRVLREFGY  159 (160)
Q Consensus       148 ~~Fv~sVKRLrI  159 (160)
                      -.=+...+||+|
T Consensus        67 A~~~~~~~~l~~   78 (81)
T cd06401          67 AIQCSRILKLTL   78 (81)
T ss_pred             HHhcCcceEEEE
Confidence            433444455544


No 11 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.03  E-value=0.039  Score=40.70  Aligned_cols=58  Identities=21%  Similarity=0.293  Sum_probs=43.2

Q ss_pred             ceEEEEcC---ceeeeeecc--CCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCC
Q 046002           71 PVTVVLEG---RSICQRISL--HKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGD  144 (160)
Q Consensus        71 ~VKV~MeG---~~IGRKVDL--~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGD  144 (160)
                      .||.+..|   .+==|++-|  ....+|++|...++++|....                ...+.|.|.|.|||..-+..
T Consensus         2 ~vkayl~~~~~~~EIRRf~l~~~~~~s~~~L~~~V~~~f~~l~----------------~~~ftlky~DeeGDlvtIss   64 (87)
T cd06402           2 TVKAYLLGKDANAEIRRFAIDEDVSTSYEYLVEKVAAVFPSLR----------------GKNFQLFWKDEEGDLVAFSS   64 (87)
T ss_pred             eEEEeecCCCCccceEEEEecCCCCcCHHHHHHHHHHHccccC----------------CCcEEEEEECCCCCEEeecC
Confidence            57888877   223344444  666799999999999996532                24689999999999987654


No 12 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=95.86  E-value=0.037  Score=40.73  Aligned_cols=54  Identities=19%  Similarity=0.178  Sum_probs=44.3

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG  143 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG  143 (160)
                      +|+.-.|.-.--.+|.  .-+|++|.+.+++||....                ...+++.|.|.|||.--+.
T Consensus         3 ~K~~y~gdi~it~~d~--~~s~e~L~~~v~~~c~~~~----------------~q~ft~kw~DEEGDp~tiS   56 (83)
T cd06404           3 VKAAYNGDIMITSIDP--SISLEELCNEVRDMCRFHN----------------DQPFTLKWIDEEGDPCTIS   56 (83)
T ss_pred             EEEEecCcEEEEEcCC--CcCHHHHHHHHHHHhCCCC----------------CCcEEEEEECCCCCceeec
Confidence            7999999766666666  6789999999999999853                2468999999999986554


No 13 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=95.36  E-value=0.065  Score=39.46  Aligned_cols=63  Identities=21%  Similarity=0.306  Sum_probs=49.7

Q ss_pred             eEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC-CcChHHH
Q 046002           72 VTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG-DLNWKDF  150 (160)
Q Consensus        72 VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG-DvPW~~F  150 (160)
                      -||.-+|  --|++....-=+|.+|.+.|+.+|.+...                 .+.|+|.|.|||..-+- |.--++|
T Consensus         3 fKv~~~g--~~RRf~~~~~pt~~~L~~kl~~Lf~lp~~-----------------~~~vtYiDeD~D~ITlssd~eL~d~   63 (82)
T cd06397           3 FKSSFLG--DTRRIVFPDIPTWEALASKLENLYNLPEI-----------------KVGVTYIDNDNDEITLSSNKELQDF   63 (82)
T ss_pred             EEEEeCC--ceEEEecCCCccHHHHHHHHHHHhCCChh-----------------HeEEEEEcCCCCEEEecchHHHHHH
Confidence            4888888  57999999999999999999999999742                 16799999999987544 4555555


Q ss_pred             Hhc
Q 046002          151 VRV  153 (160)
Q Consensus       151 v~s  153 (160)
                      .+-
T Consensus        64 ~~~   66 (82)
T cd06397          64 YRL   66 (82)
T ss_pred             HHh
Confidence            543


No 14 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=92.98  E-value=0.42  Score=35.29  Aligned_cols=53  Identities=19%  Similarity=0.265  Sum_probs=43.6

Q ss_pred             ceEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCC
Q 046002           71 PVTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGD  144 (160)
Q Consensus        71 ~VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGD  144 (160)
                      -|||+-.|.  -|-|-+..-=+|++|...+.++|+...                  .+.|-|.|. ||..-+++
T Consensus         4 kVKv~~~~D--v~~i~v~~~i~f~dL~~kIrdkf~~~~------------------~~~iKykDE-GD~iti~s   56 (86)
T cd06408           4 RVKVHAQDD--TRYIMIGPDTGFADFEDKIRDKFGFKR------------------RLKIKMKDD-GDMITMGD   56 (86)
T ss_pred             EEEEEecCc--EEEEEcCCCCCHHHHHHHHHHHhCCCC------------------ceEEEEEcC-CCCccccC
Confidence            489998887  566666667779999999999998742                  467999999 99988876


No 15 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=84.92  E-value=1.7  Score=32.72  Aligned_cols=43  Identities=23%  Similarity=0.302  Sum_probs=34.4

Q ss_pred             eeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEc
Q 046002           81 ICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLA  142 (160)
Q Consensus        81 IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLV  142 (160)
                      |+=.=||+.--+|.+|.....+-|.....                   .|-|.|.|||+.-+
T Consensus        18 i~vee~l~~~P~~kdLl~lmr~~f~~~dI-------------------aLNYrD~EGDLIRl   60 (92)
T cd06399          18 IAVEEDLSSTPLLKDLLELTRREFQREDI-------------------ALNYRDAEGDLIRL   60 (92)
T ss_pred             eEeecccccCccHHHHHHHHHHHhchhhe-------------------eeeeecCCCCEEEE
Confidence            44444788889999999999999988643                   47899999998744


No 16 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=62.79  E-value=15  Score=27.52  Aligned_cols=49  Identities=14%  Similarity=0.267  Sum_probs=36.0

Q ss_pred             cCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcC
Q 046002           77 EGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAG  143 (160)
Q Consensus        77 eG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVG  143 (160)
                      +|.++--.||...+=++.++..++.+.......                  =.+-|||.+||..-|-
T Consensus         9 ~gg~vDw~V~~~~~L~F~DvL~~I~~vlp~aT~------------------tAFeYEDE~gDRITVR   57 (91)
T cd06395           9 NGGAVDWTVQSGPQLLFRDVLDVIGQVLPEATT------------------TAFEYEDEDGDRITVR   57 (91)
T ss_pred             CCCcccccccCcccccHHHHHHHHHHhcccccc------------------cceeeccccCCeeEec
Confidence            455677778877778899999988876554332                  1368999999998774


No 17 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=52.42  E-value=13  Score=24.71  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=14.6

Q ss_pred             EEEEEcCCCCeEEcCCc
Q 046002          129 LIAYEDMENDLLLAGDL  145 (160)
Q Consensus       129 ~l~YeD~EGD~MLVGDv  145 (160)
                      -+.|.|.+|+.+++|+.
T Consensus        34 ~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   34 GILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             EEEEEETTSSEEEES-E
T ss_pred             eEEEEcCCCCEEEEeEE
Confidence            48999999999999974


No 18 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=49.47  E-value=73  Score=23.27  Aligned_cols=65  Identities=17%  Similarity=0.211  Sum_probs=46.8

Q ss_pred             ceEEEEcCceeeeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCC-CeEEcCCcChHH
Q 046002           71 PVTVVLEGRSICQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMEN-DLLLAGDLNWKD  149 (160)
Q Consensus        71 ~VKV~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EG-D~MLVGDvPW~~  149 (160)
                      -|||+-++   .=.|-...=-+|.+|...|.+-+....+                 +=+|-|.|.+. +...++|.-++.
T Consensus         4 vvKV~f~~---tIaIrvp~~~~y~~L~~ki~~kLkl~~e-----------------~i~LsYkde~s~~~v~l~d~dle~   63 (80)
T cd06406           4 VVKVHFKY---TVAIQVARGLSYATLLQKISSKLELPAE-----------------HITLSYKSEASGEDVILSDTNMED   63 (80)
T ss_pred             EEEEEEEE---EEEEEcCCCCCHHHHHHHHHHHhCCCch-----------------hcEEEeccCCCCCccCcChHHHHH
Confidence            38999998   3345566667899999999999988632                 12578887764 444448888887


Q ss_pred             HHhccc
Q 046002          150 FVRVLR  155 (160)
Q Consensus       150 Fv~sVK  155 (160)
                      =.+.|+
T Consensus        64 aws~~~   69 (80)
T cd06406          64 VWSQAK   69 (80)
T ss_pred             HHHhhc
Confidence            777665


No 19 
>PF00788 RA:  Ras association (RalGDS/AF-6) domain;  InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals []. This factor stimulates the dissociation of GDP from the Ras-related RALA and RALB GTPases, which allows GTP binding and activation of the GTPases. It interacts and acts as an effector molecule for R-ras, K-Ras and Rap []. The domain is also present in a number of other proteins among them the sexual differentiation protein in yeast that is essential for mating and meiosis and yeast adenylate cyclase. These proteins contain repeated leucine-rich (LRR) segments.; GO: 0007165 signal transduction; PDB: 3EC8_A 2C5L_D 2BYF_A 2CS4_A 3KH0_A 2B3A_A 1RAX_A 2RGF_A 1WGR_A 1WXA_A ....
Probab=39.14  E-value=85  Score=21.16  Aligned_cols=68  Identities=10%  Similarity=0.012  Sum_probs=48.3

Q ss_pred             CceEEEEcCcee---eeeeccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEE--EEEcCCCCeEEcCC
Q 046002           70 PPVTVVLEGRSI---CQRISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLI--AYEDMENDLLLAGD  144 (160)
Q Consensus        70 ~~VKV~MeG~~I---GRKVDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l--~YeD~EGD~MLVGD  144 (160)
                      .++||++....-   -+.|-++....-.+++.++.+.|++...               ...|.|  .-........|-.|
T Consensus         3 ~~lrVy~~~~~~~~~~k~i~v~~~tTa~evi~~~l~k~~l~~~---------------~~~y~L~~~~~~~~~er~L~~~   67 (93)
T PF00788_consen    3 GVLRVYDGDGSPGSTYKTIKVSSSTTAREVIEMALEKFGLAED---------------PSDYCLVEVEESGGEERPLDDD   67 (93)
T ss_dssp             EEEEEEETTSSSCCSEEEEEEETTSBHHHHHHHHHHHTTTSSS---------------GGGEEEEEEECTTTEEEEETTT
T ss_pred             eEEEEEcCCCCCCccEEEEEECCCCCHHHHHHHHHHHhCCCCC---------------CCCEEEEEEEcCCCEEEEcCCC
Confidence            368899887653   6888999999999999999999999321               246888  44455556666543


Q ss_pred             -cChHHHHh
Q 046002          145 -LNWKDFVR  152 (160)
Q Consensus       145 -vPW~~Fv~  152 (160)
                       .|+.....
T Consensus        68 E~pl~i~~~   76 (93)
T PF00788_consen   68 ECPLQIQLQ   76 (93)
T ss_dssp             SBHHHHHHT
T ss_pred             CchHHHHHh
Confidence             56665544


No 20 
>PF09840 DUF2067:  Uncharacterized protein conserved in archaea (DUF2067);  InterPro: IPR019202  This family of archaeal proteins, have no known function. 
Probab=34.13  E-value=26  Score=29.00  Aligned_cols=29  Identities=14%  Similarity=0.290  Sum_probs=25.1

Q ss_pred             CCCcEEEEEcCCCCeEEcCCcChHHHHhcccee
Q 046002          125 VPGHLIAYEDMENDLLLAGDLNWKDFVRVLREF  157 (160)
Q Consensus       125 ~~~~~l~YeD~EGD~MLVGDvPW~~Fv~sVKRL  157 (160)
                      ..||..-|.+.    -+..|.||+++++.++||
T Consensus        97 ~~G~~ae~~~~----~i~T~a~~eev~~l~~~L  125 (190)
T PF09840_consen   97 LLGYKAEYRED----VIKTDAPLEEVVELAERL  125 (190)
T ss_pred             hCCCeeEEeCC----eEEecCCHHHHHHHHHHH
Confidence            36788888766    889999999999999987


No 21 
>PF14688 DUF4461:  Domain of unknown function (DUF4461)
Probab=33.87  E-value=29  Score=30.61  Aligned_cols=30  Identities=23%  Similarity=0.734  Sum_probs=22.1

Q ss_pred             CCcEEEEE-----cCCCCeEE-cCCcC--hHHHHhccc
Q 046002          126 PGHLIAYE-----DMENDLLL-AGDLN--WKDFVRVLR  155 (160)
Q Consensus       126 ~~~~l~Ye-----D~EGD~ML-VGDvP--W~~Fv~sVK  155 (160)
                      .|.+|++-     |.+|++|| +||||  |..|++.+.
T Consensus        80 ~G~tvvF~~~sGv~~~G~v~L~~~Dv~~~W~~~l~~l~  117 (313)
T PF14688_consen   80 KGRTVVFGDFSGVSLDGHVMLGTGDVPHQWTSFLERLP  117 (313)
T ss_pred             CCCEEEecCCCccCCCCCEEecCCCcHHHHHHHHHhCC
Confidence            46677775     67888887 67877  888887654


No 22 
>PF09277 Erythro-docking:  Erythronolide synthase, docking;  InterPro: IPR015357 Docking domains are found in prokaryotic erythronolide synthase. They adopt a structure consisting of a bundle of four alpha-helices, and mediate homodimerisation of the protein, stabilising the resulting complex []. ; PDB: 1PZQ_A.
Probab=29.75  E-value=22  Score=24.62  Aligned_cols=16  Identities=63%  Similarity=1.010  Sum_probs=12.5

Q ss_pred             hhhHHHHhhhhhcCCC
Q 046002           14 QRQESLKRRWQERRAV   29 (160)
Q Consensus        14 ~~~~~~~~~~~~~~~~   29 (160)
                      +|-+.|-||||..+++
T Consensus        33 aRLeaLLR~Wq~~r~~   48 (58)
T PF09277_consen   33 ARLEALLRRWQDRRAP   48 (58)
T ss_dssp             HHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHhccCC
Confidence            5678999999986654


No 23 
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional
Probab=27.77  E-value=2e+02  Score=24.82  Aligned_cols=75  Identities=7%  Similarity=0.017  Sum_probs=44.5

Q ss_pred             EEEcCceeeeeec--cCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCCcChHHHH
Q 046002           74 VVLEGRSICQRIS--LHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGDLNWKDFV  151 (160)
Q Consensus        74 V~MeG~~IGRKVD--L~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGDvPW~~Fv  151 (160)
                      .+.+-.|+|+--+  -..+=+.+++...|++.+.......        .. ++.+.| ....|..|-+=++.-+-.. ||
T Consensus       187 ~~ie~mP~g~~~~~~~~~~~~~~e~~~~l~~~~~~~~~~~--------~~-~~~~~~-~~~~~~~~~ig~I~~~s~~-fC  255 (329)
T PRK13361        187 AFIEEMPLGEIDERRRARHCSSDEVRAIIETRYPLTPSNK--------RT-GGPARY-YTMADSPIHIGFISPHSHN-FC  255 (329)
T ss_pred             EEEecccCCCccchhhccCcCHHHHHHHHHHhCCcccCCC--------CC-CCCCeE-EEECCCCeEEEEEcCCCcc-cc
Confidence            3566778887322  3456678888888988876432210        00 111111 1223445556566666666 99


Q ss_pred             hccceeEe
Q 046002          152 RVLREFGY  159 (160)
Q Consensus       152 ~sVKRLrI  159 (160)
                      .+|.||||
T Consensus       256 ~~Cnr~rl  263 (329)
T PRK13361        256 HECNRVRV  263 (329)
T ss_pred             ccCCeEEE
Confidence            99999998


No 24 
>COG3286 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.41  E-value=37  Score=28.86  Aligned_cols=29  Identities=24%  Similarity=0.480  Sum_probs=24.7

Q ss_pred             CCCcEEEEEcCCCCeEEcCCcChHHHHhcccee
Q 046002          125 VPGHLIAYEDMENDLLLAGDLNWKDFVRVLREF  157 (160)
Q Consensus       125 ~~~~~l~YeD~EGD~MLVGDvPW~~Fv~sVKRL  157 (160)
                      .-||.+-|.+.+    |=-+.||++|++.|++|
T Consensus       100 ~~GyrVevr~~~----l~T~ap~~ev~E~vreL  128 (204)
T COG3286         100 LLGYRVEVRGGE----LKTNAPWSEVVELVREL  128 (204)
T ss_pred             hCCceEEeeCce----eecCCCHHHHHHHHHHH
Confidence            358889888665    88999999999999886


No 25 
>PF12108 SF3a60_bindingd:  Splicing factor SF3a60 binding domain;  InterPro: IPR021966  This domain is found in eukaryotes. This domain is about 30 amino acids in length. This domain has a single completely conserved residue Y that may be functionally important. SF3a60 makes up the SF3a complex with SF3a66 and SF3a120. This domain is the binding site of SF3a60 for SF3a120. The SF3a complex is part of the spliceosome, a protein complex involved in splicing mRNA after transcription. ; PDB: 2DT7_A.
Probab=27.35  E-value=12  Score=22.41  Aligned_cols=18  Identities=22%  Similarity=0.493  Sum_probs=11.9

Q ss_pred             EcCCcChHHHHhccceeE
Q 046002          141 LAGDLNWKDFVRVLREFG  158 (160)
Q Consensus       141 LVGDvPW~~Fv~sVKRLr  158 (160)
                      +-|..||++|-+-.|.|+
T Consensus         3 is~~d~f~eFY~rlk~Ik   20 (28)
T PF12108_consen    3 ISGGDPFSEFYERLKEIK   20 (28)
T ss_dssp             --S--HHHHHHHHHHHHH
T ss_pred             CCCCChHHHHHHHHHHHH
Confidence            348899999998888764


No 26 
>PF13665 DUF4150:  Domain of unknown function (DUF4150)
Probab=27.29  E-value=46  Score=25.21  Aligned_cols=23  Identities=22%  Similarity=0.235  Sum_probs=20.3

Q ss_pred             ceEEEEcCceeeeeeccCCCCCH
Q 046002           71 PVTVVLEGRSICQRISLHKHASY   93 (160)
Q Consensus        71 ~VKV~MeG~~IGRKVDL~~~~sY   93 (160)
                      -.+|..||.++.|--|+...++.
T Consensus        83 S~~V~ieG~p~~R~~d~~~~N~~  105 (110)
T PF13665_consen   83 SFTVKIEGKPATRLTDLTWMNNK  105 (110)
T ss_pred             CCeEEECCEEEEEcCCCccccCC
Confidence            36899999999999999988764


No 27 
>PF07929 PRiA4_ORF3:  Plasmid pRiA4b ORF-3-like protein;  InterPro: IPR012912 Members of this family are similar to the protein product of ORF-3 (Q44206 from SWISSPROT) found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumourigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process []. Other proteins found in this family are annotated as being putative TnpR resolvases (Q9LCU7 from SWISSPROT, Q50439 from SWISSPROT), but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor (Q7UEI4 from SWISSPROT) and in fact carries a LexA DNA binding domain (IPR006199 from INTERPRO), but no references were found to expand on this. ; PDB: 2I1S_A.
Probab=27.07  E-value=87  Score=24.63  Aligned_cols=38  Identities=21%  Similarity=0.341  Sum_probs=29.7

Q ss_pred             ceEEEEcCc--eeeeeeccCCCCCHHHHHHHHHHhhccCc
Q 046002           71 PVTVVLEGR--SICQRISLHKHASYQSLAKALRQMFVEGG  108 (160)
Q Consensus        71 ~VKV~MeG~--~IGRKVDL~~~~sY~eL~~~L~~MF~~~~  108 (160)
                      -+||...|.  +|=|+|-+..-.+..+|...|...|+-..
T Consensus         6 ~lkV~L~~~~p~iwRri~Vp~~~tl~~Lh~~Iq~afgw~~   45 (179)
T PF07929_consen    6 QLKVSLKGSKPPIWRRIEVPADITLADLHEVIQAAFGWDD   45 (179)
T ss_dssp             EEEEEETT-SS-EEEEEEEETT-BHHHHHHHHHHHTT---
T ss_pred             EEEEEEcCCCCCeEEEEEECCCCCHHHHHHHHHHHhCcCC
Confidence            368888884  89999999999999999999999998643


No 28 
>PF06463 Mob_synth_C:  Molybdenum Cofactor Synthesis C;  InterPro: IPR010505 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [, ].  In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner []. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF []. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 (Q39054 from SWISSPROT) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) []. This entry represents MoaA, which belongs to a family of enzymes involved in the synthesis of metallo-cofactors (IPR000385 from INTERPRO). Each subunit of the MoaA dimer is comprised of an N-terminal SAM domain (IPR007197 from INTERPRO) that contains the [4Fe-4S] cluster typical for this family of enzymes, as well as an additional [4Fe-4S] cluster in the C-terminal domain that is unique to MoaA proteins []. The unique Fe site of the C-terminal [4Fe-4S] cluster is thought to be involved in the binding and activation of 5'-GTP. Mutations in the human MoCF biosynthesis proteins MOCS1, MOCS2 or GEPH cause MoCF Deficiency type A (MOCOD), causing the loss of activity of MoCF-containing enzymes, resulting in neurological abnormalities and death [].; GO: 0051539 4 iron, 4 sulfur cluster binding, 0006777 Mo-molybdopterin cofactor biosynthetic process, 0019008 molybdopterin synthase complex; PDB: 2FB2_A 2FB3_A 1TV8_B 1TV7_A.
Probab=26.74  E-value=1.5e+02  Score=22.46  Aligned_cols=64  Identities=6%  Similarity=0.005  Sum_probs=30.7

Q ss_pred             eccCCCCCHHHHHHHHHHhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCCcChHHHHhccceeEe
Q 046002           85 ISLHKHASYQSLAKALRQMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGDLNWKDFVRVLREFGY  159 (160)
Q Consensus        85 VDL~~~~sY~eL~~~L~~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGDvPW~~Fv~sVKRLrI  159 (160)
                      +--..|-+++++...|++.+.......     +.   .  .+--.....+..|..=++.-+-=. ||.+|.||||
T Consensus        17 ~~~~~~~~~~ei~~~l~~~~~~~~~~~-----~~---~--~pa~~y~~~g~~g~vG~I~~~s~~-FC~~CNRiRl   80 (128)
T PF06463_consen   17 WFEEEFVPAQEILERLEERYELLPSEK-----RP---N--GPARYYRIPGGKGRVGFISPVSNP-FCSSCNRIRL   80 (128)
T ss_dssp             B-TTTB--HHHHHHHHHHHS-EEEE-------SS---T---SSEEEEETTT--EEEEE-TTTS---GGG--EEEE
T ss_pred             chhhcCcCHHHHHHHHHHhCCcccccc-----cc---C--CcceEEEECCCCcEEEEEeCCCCC-CCCcCCEEEE
Confidence            344778889999999999888754311     00   1  111112223444445555554444 9999999998


No 29 
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=25.95  E-value=87  Score=22.37  Aligned_cols=26  Identities=12%  Similarity=0.222  Sum_probs=18.7

Q ss_pred             CCCCCCCCCCCCceEEEEcCceeeee
Q 046002           59 LDDDDLVSTVVPPVTVVLEGRSICQR   84 (160)
Q Consensus        59 ~~~~~~~~~~~~~VKV~MeG~~IGRK   84 (160)
                      +..+.+.+...+||+|.+.|...+|+
T Consensus         4 ~~~~~~~G~~dPYv~v~v~~~~~~kT   29 (111)
T cd04052           4 DTSESKTGLLSPYAELYLNGKLVYTT   29 (111)
T ss_pred             ccccccCCCCCceEEEEECCEEEEEE
Confidence            44555667778899999988655553


No 30 
>PF07521 RMMBL:  RNA-metabolising metallo-beta-lactamase;  InterPro: IPR011108 The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 from INTERPRO and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in RNA metabolism [].; PDB: 3ZQ4_D 2I7T_A 2I7V_A 2YCB_B 3BK1_A 3T3N_A 3BK2_A 3T3O_A 3AF5_A 3AF6_A ....
Probab=24.16  E-value=81  Score=19.65  Aligned_cols=21  Identities=24%  Similarity=0.442  Sum_probs=18.0

Q ss_pred             eeeccCCCCCHHHHHHHHHHh
Q 046002           83 QRISLHKHASYQSLAKALRQM  103 (160)
Q Consensus        83 RKVDL~~~~sY~eL~~~L~~M  103 (160)
                      ..+|++.|.++++|..-++.|
T Consensus        10 ~~~~fSgHad~~~L~~~i~~~   30 (43)
T PF07521_consen   10 EQIDFSGHADREELLEFIEQL   30 (43)
T ss_dssp             EESGCSSS-BHHHHHHHHHHH
T ss_pred             EEEeecCCCCHHHHHHHHHhc
Confidence            368999999999999999888


No 31 
>COG0219 CspR Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis]
Probab=23.70  E-value=34  Score=27.94  Aligned_cols=55  Identities=20%  Similarity=0.239  Sum_probs=38.5

Q ss_pred             cCceeeeeeccCCCCCHHHHHHHHH---HhhccCccccccccccccccCCCCCCcEEEEEcCCCCeEEcCCcC
Q 046002           77 EGRSICQRISLHKHASYQSLAKALR---QMFVEGGEAAAINSEQDLDLSNAVPGHLIAYEDMENDLLLAGDLN  146 (160)
Q Consensus        77 eG~~IGRKVDL~~~~sY~eL~~~L~---~MF~~~~~~~~~~~~~~ldl~~~~~~~~l~YeD~EGD~MLVGDvP  146 (160)
                      -|-.+--+++|..|+++++...+..   ++|-......              .-| .-+....||++|-|-++
T Consensus        48 AGlDY~~~~~l~~h~s~e~fl~~~~~~~rl~~~tt~~~--------------~~~-~~~~f~~~d~llFG~Es  105 (155)
T COG0219          48 AGLDYHEKASLTEHDSLEAFLEAEPIGGRLFALTTKGT--------------TTY-TDVSFQKGDYLLFGPES  105 (155)
T ss_pred             cccchHhhcceEEeCCHHHHHhhccCCceEEEEEeccc--------------ccc-ccccCCCCCEEEECCCC
Confidence            5778999999999999999999984   5666544311              001 11344568999999754


No 32 
>PF02013 CBM_10:  Cellulose or protein binding domain;  InterPro: IPR002883 This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria. The recycling of photosynthetically fixed carbon in plant cell walls is a key microbial process. Enzyme systems that attack the plant cell wall contain noncatalytic carbohydrate-binding modules that mediate attachment to this composite structure and play a pivotal role in maximizing the hydrolytic process. In anaerobes, the degradation is carried out by a high molecular weight, multifunctional complex termed the cellulosome. This consists of a number of independent enzyme components, each of which contains a conserved 40-residue dockerin domain, which functions to bind the enzyme to a cohesin domain within the scaffoldin protein [, ].  In anaerobic bacteria that degrade plant cell walls, exemplified by Clostridium thermocellum, the dockerin domains of the catalytic polypeptides can bind equally well to any cohesin from the same organism. More recently, anaerobic fungi, typified by Piromyces equi, have been suggested to also synthesise a cellulosome complex, although the dockerin sequences of the bacterial and fungal enzymes are completely different []. For example, the fungal enzymes contain one, two or three copies of the dockerin sequence in tandem within the catalytic polypeptide. In contrast, all the C. thermocellum cellulosome catalytic components contain a single dockerin domain. The anaerobic bacterial dockerins are homologous to EF hands (calcium-binding motifs) and require calcium for activity whereas the fungal dockerin does not require calcium. Finally, the interaction between cohesin and dockerin appears to be species specific in bacteria, there is almost no species specificity of binding within fungal species and no identified sites that distinguish different species.  The structure of dockerin from P. equi contains two helical stretches and four short beta-strands which form an antiparallel sheet structure adjacent to an additional short twisted parallel strand. The N- and C-termini are adjacent to each other.  Aerobic bacteria contain related regions, however these appear to function as cellulose/carbohydrate binding domains.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2J4M_A 2J4N_A 1E8R_A 1QLD_A 1E8P_A 1E8Q_A.
Probab=23.46  E-value=24  Score=22.18  Aligned_cols=12  Identities=17%  Similarity=0.221  Sum_probs=8.9

Q ss_pred             EEEEEcCCCCeE
Q 046002          129 LIAYEDMENDLL  140 (160)
Q Consensus       129 ~l~YeD~EGD~M  140 (160)
                      .+.|+|.+|+|=
T Consensus        16 ~v~y~d~~g~WG   27 (36)
T PF02013_consen   16 EVVYTDDDGGWG   27 (36)
T ss_dssp             --SEEETTEEEE
T ss_pred             ceEEcCCCCCEe
Confidence            589999999983


No 33 
>PF09676 TraV:  Type IV conjugative transfer system lipoprotein (TraV);  InterPro: IPR014118 This entry represents TraV, a component of a conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK [, , ]. This protein contains three conserved cysteines in the N-terminal half.
Probab=22.67  E-value=57  Score=23.98  Aligned_cols=19  Identities=26%  Similarity=0.361  Sum_probs=16.1

Q ss_pred             CcEEEEEcCCCCeEEcCCc
Q 046002          127 GHLIAYEDMENDLLLAGDL  145 (160)
Q Consensus       127 ~~~l~YeD~EGD~MLVGDv  145 (160)
                      =|+.-|+|.+||+-.-|.|
T Consensus        92 iwiaP~~D~~g~l~~~~~V  110 (119)
T PF09676_consen   92 IWIAPWEDADGDLHDPGYV  110 (119)
T ss_pred             EEEeeeECCCCCEeccceE
Confidence            4899999999999877654


No 34 
>PF04566 RNA_pol_Rpb2_4:  RNA polymerase Rpb2, domain 4;  InterPro: IPR007646 RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 4, is also known as the external 2 domain [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3S17_B 1I6H_B 4A3B_B 3K1F_B 4A3I_B 1TWA_B 3S14_B 3S15_B 2NVX_B 3M3Y_B ....
Probab=21.64  E-value=1.1e+02  Score=20.91  Aligned_cols=27  Identities=33%  Similarity=0.388  Sum_probs=22.1

Q ss_pred             EEEcCceeeeeeccCCCCCHHHHHHHHHHhhcc
Q 046002           74 VVLEGRSICQRISLHKHASYQSLAKALRQMFVE  106 (160)
Q Consensus        74 V~MeG~~IGRKVDL~~~~sY~eL~~~L~~MF~~  106 (160)
                      |+..|..||-      ++..++|...|.+|=..
T Consensus         1 VFlNG~~iG~------~~~p~~l~~~lr~~RR~   27 (63)
T PF04566_consen    1 VFLNGVWIGI------HSDPEELVKTLRNLRRS   27 (63)
T ss_dssp             EEETTEEEEE------ESSHHHHHHHHHHHHHT
T ss_pred             CEECCEEEEE------EcCHHHHHHHHHHHhhc
Confidence            7889999994      56779999999998554


No 35 
>PF04809 HupH_C:  HupH hydrogenase expression protein, C-terminal conserved region;  InterPro: IPR006894 This entry represents the C-terminal conserved domain found in bacterial hydrogenase expression proteins (HupH), which are necessary for hydrogenase synthesis. The precise function of HupH is unknown [].; PDB: 3SB1_A.
Probab=21.12  E-value=84  Score=24.11  Aligned_cols=31  Identities=16%  Similarity=0.246  Sum_probs=21.3

Q ss_pred             CcEEEEEcCCC----CeEEcCCcCh------HHHHhcccee
Q 046002          127 GHLIAYEDMEN----DLLLAGDLNW------KDFVRVLREF  157 (160)
Q Consensus       127 ~~~l~YeD~EG----D~MLVGDvPW------~~Fv~sVKRL  157 (160)
                      =|.+.|.|.+|    |.+-||++|=      +++..++.||
T Consensus        72 VWrV~~~n~~~~~i~d~iEV~~vP~~v~aa~eD~~ds~~rL  112 (120)
T PF04809_consen   72 VWRVRYFNSDGRLILDTIEVGDVPEVVRAAPEDLADSAARL  112 (120)
T ss_dssp             EEEEEEE-TTS-EEEEEEEESSS-GGGS--HHHHHHHHHHH
T ss_pred             EEEEEEECCCCCEeeeeEEEeCCcHHHhccHhhHHHHHHHH
Confidence            49999999997    5677999994      4455555555


No 36 
>PRK11430 putative CoA-transferase; Provisional
Probab=20.63  E-value=94  Score=27.84  Aligned_cols=26  Identities=8%  Similarity=0.176  Sum_probs=19.5

Q ss_pred             EEEEcCCCCeEEc---CCcChHHHHhccce
Q 046002          130 IAYEDMENDLLLA---GDLNWKDFVRVLRE  156 (160)
Q Consensus       130 l~YeD~EGD~MLV---GDvPW~~Fv~sVKR  156 (160)
                      =+|+=+|| |+.+   .|--|+.||+.+.|
T Consensus       240 ~~y~~~DG-~i~i~~~~~~~w~~l~~~lg~  268 (381)
T PRK11430        240 DVFDTQDK-PITICCGNDKLFSALCQALEL  268 (381)
T ss_pred             CceEcCCC-cEEEEeCCHHHHHHHHHHhCC
Confidence            36999999 7766   45579999987654


Done!