Query         046004
Match_columns 157
No_of_seqs    178 out of 435
Neff          6.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:44:18 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046004.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046004hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14009 DUF4228:  Domain of un 100.0 4.1E-40 8.9E-45  253.0  12.8  153    1-155     1-181 (181)
  2 PRK08053 sulfur carrier protei  73.6      10 0.00022   24.7   4.7   22   15-36      3-24  (66)
  3 PRK06944 sulfur carrier protei  71.1      16 0.00035   23.2   5.3   54   15-68      3-60  (65)
  4 PF02824 TGS:  TGS domain;  Int  70.5     7.6 0.00017   24.9   3.5   25   12-36      1-25  (60)
  5 TIGR01683 thiS thiamine biosyn  59.6      24 0.00053   22.6   4.4   23   15-37      1-23  (64)
  6 PRK06083 sulfur carrier protei  59.1      10 0.00022   26.4   2.6   23   15-37     21-43  (84)
  7 PRK05659 sulfur carrier protei  54.0      15 0.00032   23.6   2.6   23   15-37      3-25  (66)
  8 PRK07440 hypothetical protein;  50.4      19  0.0004   23.9   2.7   24   13-36      5-28  (70)
  9 cd00565 ThiS ThiaminS ubiquiti  49.9      53  0.0012   21.0   4.8   23   15-37      2-24  (65)
 10 PF13545 HTH_Crp_2:  Crp-like h  43.0      45 0.00098   21.4   3.7   37   96-132    20-56  (76)
 11 cd01668 TGS_RelA_SpoT TGS_RelA  40.4      40 0.00087   20.4   3.0   24   13-36      2-25  (60)
 12 cd00178 STI Soybean trypsin in  39.8      23 0.00051   27.6   2.2   18   54-71      6-23  (172)
 13 PRK05863 sulfur carrier protei  39.5      34 0.00075   22.1   2.6   23   15-37      3-25  (65)
 14 PF00197 Kunitz_legume:  Trypsi  38.8      25 0.00054   27.4   2.2   18   54-71      6-23  (176)
 15 PF14237 DUF4339:  Domain of un  35.0      15 0.00032   22.1   0.3   10  140-149    36-45  (45)
 16 PRK07696 sulfur carrier protei  33.3      49  0.0011   21.6   2.6   22   15-36      3-25  (67)
 17 PRK06437 hypothetical protein;  31.7 1.5E+02  0.0032   19.3   5.0   52   15-69      5-63  (67)
 18 PF01402 RHH_1:  Ribbon-helix-h  31.7   1E+02  0.0022   17.3   4.6   31  100-130     1-34  (39)
 19 PF00325 Crp:  Bacterial regula  31.5      53  0.0011   18.8   2.2   28  103-130     1-28  (32)
 20 smart00452 STI Soybean trypsin  30.2      39 0.00084   26.4   2.0   18   54-71      5-22  (172)
 21 PF10723 RepB-RCR_reg:  Replica  28.9 1.6E+02  0.0035   20.3   4.8   36   96-131    39-77  (84)
 22 PHA02843 hypothetical protein;  28.5      23  0.0005   23.4   0.4   14    1-14      1-14  (73)
 23 PRK06488 sulfur carrier protei  24.6      83  0.0018   20.0   2.5   22   15-37      3-24  (65)
 24 smart00419 HTH_CRP helix_turn_  23.6   1E+02  0.0023   17.5   2.7   34   99-132     3-36  (48)
 25 cd02980 TRX_Fd_family Thioredo  23.5      88  0.0019   20.1   2.5   33    1-36     44-76  (77)
 26 COG2104 ThiS Sulfur transfer p  22.6      98  0.0021   20.6   2.6   23   15-37      5-27  (68)
 27 PRK08364 sulfur carrier protei  21.9 2.4E+02  0.0051   18.3   5.0   52   15-69      7-66  (70)
 28 cd03063 TRX_Fd_FDH_beta TRX-li  20.9 1.3E+02  0.0029   21.1   3.1   24    9-34     48-71  (92)
 29 PF03990 DUF348:  Domain of unk  20.4 1.6E+02  0.0036   17.3   3.1   23   15-37      4-27  (43)

No 1  
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=100.00  E-value=4.1e-40  Score=253.05  Aligned_cols=153  Identities=37%  Similarity=0.643  Sum_probs=115.3

Q ss_pred             CCCcccc------CCceeEEEecCCcEEEEeCCCcHHHHHhhcCCcEEeCCC-----CCccCCCCCCccCCCCeEEEeeC
Q 046004            1 MGNCLVL------EEKVIKVMKTDGKILEYNQPIRVQDVLAEFSGHAISDSL-----PEIRHLRPDFKLVGGNLYFLVPV   69 (157)
Q Consensus         1 MGNC~~~------~~~~ikV~~~dG~v~e~~~pv~a~~vm~~~Pgh~v~~s~-----~~~~~L~~d~~L~~G~~YfLlP~   69 (157)
                      ||||++.      ..++||||++||+|++|+.||+|+|||.+|||||||++.     ..+++|+||++|++|++|||||.
T Consensus         1 MGn~~~~~~~~~~~~~~vkvv~~~G~v~~~~~pv~a~evm~~~P~h~v~~~~~~~~~~~~~~l~~d~~L~~G~~Y~llP~   80 (181)
T PF14009_consen    1 MGNCVSCCLASSSSAATVKVVHPDGKVEEFKRPVTAAEVMLENPGHFVCDSDSFRFGRRIKPLPPDEELQPGQIYFLLPM   80 (181)
T ss_pred             CCCcccccccccCCCceEEEEcCCCcEEEeCCCcCHHHHHHHCCCCEEeccccccCCCcccCCCccCeecCCCEEEEEEc
Confidence            9999985      689999999999999999999999999999999998763     46799999999999999999999


Q ss_pred             CCCCchhc---cccccccchhcc------------c--CCcCCCceEEEEEEeCHHHHHHHHHhccCCHHHHHHHHHhhc
Q 046004           70 PLPSQKVQ---KKKVRFSDEEAG------------A--GAKERGGVVRIKLVISKQELEELLQKQGVSVKDMVSRIQSKQ  132 (157)
Q Consensus        70 ~~~~~~~~---~~~vr~~~~~~~------------~--~~~~~~g~~rvkl~i~k~~L~~ll~~~~~s~e~~l~~l~~~~  132 (157)
                      +.......   .....+......            .  ....++|++++|++++++||++++++.  +.++++....+..
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~rvki~isk~el~~~l~~~--s~~~~~~~~~~~~  158 (181)
T PF14009_consen   81 SRLQSVLSASDMASLASSASSASSSSSARKSSSRPFSRSRSSNGGVVRVKIVISKEELEELLSEG--SDEEMLSESCRRP  158 (181)
T ss_pred             cccCcccccchhcccccchhhccccccccccccccccccccccCcccccccccCHHHHHHHHhcc--ccchhhhhhhccc
Confidence            98654211   111111111100            0  123467889999999999999999866  5666666555432


Q ss_pred             cccccccCCCCCCccccCcCcCC
Q 046004          133 SADDFQSGDNTKAWKPELESIPE  155 (157)
Q Consensus       133 ~~~~~~~~~~~~~WrP~LeSIpE  155 (157)
                      .........+.++|||+||||||
T Consensus       159 ~~~~~~~~~~~~~WrP~LesI~E  181 (181)
T PF14009_consen  159 RRRSSRRGSRSRSWRPALESIPE  181 (181)
T ss_pred             cccccccCCCCCCccCCCCCcCc
Confidence            21112233466999999999998


No 2  
>PRK08053 sulfur carrier protein ThiS; Provisional
Probab=73.62  E-value=10  Score=24.68  Aligned_cols=22  Identities=9%  Similarity=0.214  Sum_probs=20.0

Q ss_pred             EecCCcEEEEeCCCcHHHHHhh
Q 046004           15 MKTDGKILEYNQPIRVQDVLAE   36 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~   36 (157)
                      +..||+..++..++++.+++..
T Consensus         3 i~vNg~~~~~~~~~tl~~ll~~   24 (66)
T PRK08053          3 ILFNDQPMQCAAGQTVHELLEQ   24 (66)
T ss_pred             EEECCeEEEcCCCCCHHHHHHH
Confidence            5679999999999999999975


No 3  
>PRK06944 sulfur carrier protein ThiS; Provisional
Probab=71.15  E-value=16  Score=23.21  Aligned_cols=54  Identities=20%  Similarity=0.217  Sum_probs=32.3

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc---CCcEE-eCCCCCccCCCCCCccCCCCeEEEee
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF---SGHAI-SDSLPEIRHLRPDFKLVGGNLYFLVP   68 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~---Pgh~v-~~s~~~~~~L~~d~~L~~G~~YfLlP   68 (157)
                      |..||+..++....++++++...   |+..+ .+..-..+.-..+..|+.|--.-++|
T Consensus         3 i~vNg~~~~~~~~~tl~~ll~~l~~~~~~~v~vN~~~v~~~~~~~~~L~~gD~vei~~   60 (65)
T PRK06944          3 IQLNQQTLSLPDGATVADALAAYGARPPFAVAVNGDFVARTQHAARALAAGDRLDLVQ   60 (65)
T ss_pred             EEECCEEEECCCCCcHHHHHHhhCCCCCeEEEECCEEcCchhcccccCCCCCEEEEEe
Confidence            56799999999999999999864   33333 12211111233455666664444444


No 4  
>PF02824 TGS:  TGS domain;  InterPro: IPR004095  The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) []. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).  TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role []. ; PDB: 1WXQ_A 1NYR_B 1NYQ_B 2KMM_A 1WWT_A 1TKE_A 1TKG_A 1TJE_A 1QF6_A 1TKY_A ....
Probab=70.54  E-value=7.6  Score=24.93  Aligned_cols=25  Identities=36%  Similarity=0.384  Sum_probs=22.5

Q ss_pred             eEEEecCCcEEEEeCCCcHHHHHhh
Q 046004           12 IKVMKTDGKILEYNQPIRVQDVLAE   36 (157)
Q Consensus        12 ikV~~~dG~v~e~~~pv~a~~vm~~   36 (157)
                      |+|..+||++.+|....|+.|+-..
T Consensus         1 I~v~lpdG~~~~~~~g~T~~d~A~~   25 (60)
T PF02824_consen    1 IRVYLPDGSIKELPEGSTVLDVAYS   25 (60)
T ss_dssp             EEEEETTSCEEEEETTBBHHHHHHH
T ss_pred             CEEECCCCCeeeCCCCCCHHHHHHH
Confidence            5788899999999999999998766


No 5  
>TIGR01683 thiS thiamine biosynthesis protein ThiS. This model represents ThiS, a small thiamine-biosynthesis protein related to MoaD, a molybdenum cofactor biosynthesis protein. Both proteins are involved in sulfur transfer. ThiS has a conserved Gly-Gly C-terminus that is modified, in reactions requiring ThiI, ThiF, IscS, and a sulfur atom from Cys, into the thiocarboxylate that provides the sulfur for thiazole biosynthesis.
Probab=59.65  E-value=24  Score=22.57  Aligned_cols=23  Identities=13%  Similarity=0.384  Sum_probs=20.3

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+..++..+.++.+++...
T Consensus         1 i~iNg~~~~~~~~~tv~~ll~~l   23 (64)
T TIGR01683         1 ITVNGEPVEVEDGLTLAALLESL   23 (64)
T ss_pred             CEECCeEEEcCCCCcHHHHHHHc
Confidence            35799999999999999999874


No 6  
>PRK06083 sulfur carrier protein ThiS; Provisional
Probab=59.10  E-value=10  Score=26.36  Aligned_cols=23  Identities=4%  Similarity=0.300  Sum_probs=20.7

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+..++..++++.+++..+
T Consensus        21 I~VNG~~~~~~~~~tl~~LL~~l   43 (84)
T PRK06083         21 ISINDQSIQVDISSSLAQIIAQL   43 (84)
T ss_pred             EEECCeEEEcCCCCcHHHHHHHc
Confidence            67899999999999999999863


No 7  
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=54.04  E-value=15  Score=23.56  Aligned_cols=23  Identities=22%  Similarity=0.213  Sum_probs=20.5

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+..++..+.|+++++...
T Consensus         3 i~vNG~~~~~~~~~tl~~lL~~l   25 (66)
T PRK05659          3 IQLNGEPRELPDGESVAALLARE   25 (66)
T ss_pred             EEECCeEEEcCCCCCHHHHHHhc
Confidence            67899999999999999999863


No 8  
>PRK07440 hypothetical protein; Provisional
Probab=50.39  E-value=19  Score=23.93  Aligned_cols=24  Identities=13%  Similarity=0.295  Sum_probs=21.0

Q ss_pred             EEEecCCcEEEEeCCCcHHHHHhh
Q 046004           13 KVMKTDGKILEYNQPIRVQDVLAE   36 (157)
Q Consensus        13 kV~~~dG~v~e~~~pv~a~~vm~~   36 (157)
                      .-+..||+..++..+.++.+++.+
T Consensus         5 m~i~vNG~~~~~~~~~tl~~lL~~   28 (70)
T PRK07440          5 ITLQVNGETRTCSSGTSLPDLLQQ   28 (70)
T ss_pred             eEEEECCEEEEcCCCCCHHHHHHH
Confidence            346679999999999999999986


No 9  
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein. ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria.  The ThiS fold, like those of two closely related proteins MoaD and Urm1, is similar to that of ubiquitin although there is little or no sequence similarity.
Probab=49.92  E-value=53  Score=20.96  Aligned_cols=23  Identities=17%  Similarity=0.378  Sum_probs=20.5

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+..++..+.++.+++...
T Consensus         2 i~iNg~~~~~~~~~tv~~ll~~l   24 (65)
T cd00565           2 ITVNGEPREVEEGATLAELLEEL   24 (65)
T ss_pred             EEECCeEEEcCCCCCHHHHHHHc
Confidence            56799999999999999999774


No 10 
>PF13545 HTH_Crp_2:  Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A ....
Probab=42.97  E-value=45  Score=21.38  Aligned_cols=37  Identities=22%  Similarity=0.484  Sum_probs=30.6

Q ss_pred             CceEEEEEEeCHHHHHHHHHhccCCHHHHHHHHHhhc
Q 046004           96 GGVVRIKLVISKQELEELLQKQGVSVKDMVSRIQSKQ  132 (157)
Q Consensus        96 ~g~~rvkl~i~k~~L~~ll~~~~~s~e~~l~~l~~~~  132 (157)
                      .+...+.+-+|.++|..++.-...++..+++.|....
T Consensus        20 ~~~~~~~~~lt~~~iA~~~g~sr~tv~r~l~~l~~~g   56 (76)
T PF13545_consen   20 GDGIRIPLPLTQEEIADMLGVSRETVSRILKRLKDEG   56 (76)
T ss_dssp             TTEEEEEEESSHHHHHHHHTSCHHHHHHHHHHHHHTT
T ss_pred             CCCceEEecCCHHHHHHHHCCCHHHHHHHHHHHHHCC
Confidence            4568899999999999999866567888888888764


No 11 
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after the Threonyl-tRNA Synthetase, GTPase, and SpoT proteins where it occurs.  The function of the TGS domain is unknown.
Probab=40.39  E-value=40  Score=20.44  Aligned_cols=24  Identities=25%  Similarity=0.297  Sum_probs=20.9

Q ss_pred             EEEecCCcEEEEeCCCcHHHHHhh
Q 046004           13 KVMKTDGKILEYNQPIRVQDVLAE   36 (157)
Q Consensus        13 kV~~~dG~v~e~~~pv~a~~vm~~   36 (157)
                      -|..+||...+|..+.++.+++..
T Consensus         2 ~~~~~~g~~~~~~~~~t~~~~~~~   25 (60)
T cd01668           2 YVFTPKGEIIELPAGATVLDFAYA   25 (60)
T ss_pred             EEECCCCCEEEcCCCCCHHHHHHH
Confidence            466789999999999999998865


No 12 
>cd00178 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors. Inhibit proteases by binding with high affinity to their active sites. Trefoil fold, common to interleukins and fibroblast growth factors.
Probab=39.80  E-value=23  Score=27.59  Aligned_cols=18  Identities=22%  Similarity=0.433  Sum_probs=15.9

Q ss_pred             CCCccCCCCeEEEeeCCC
Q 046004           54 PDFKLVGGNLYFLVPVPL   71 (157)
Q Consensus        54 ~d~~L~~G~~YfLlP~~~   71 (157)
                      .+++|++|.-||++|+..
T Consensus         6 ~G~~l~~g~~YyI~p~~~   23 (172)
T cd00178           6 DGNPLRNGGRYYILPAIR   23 (172)
T ss_pred             CCCCCcCCCeEEEEEcee
Confidence            468999999999999975


No 13 
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=39.46  E-value=34  Score=22.09  Aligned_cols=23  Identities=13%  Similarity=0.268  Sum_probs=20.4

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+..++..+.++.+++...
T Consensus         3 i~vNG~~~~~~~~~tl~~ll~~l   25 (65)
T PRK05863          3 VVVNEEQVEVDEQTTVAALLDSL   25 (65)
T ss_pred             EEECCEEEEcCCCCcHHHHHHHc
Confidence            56799999999999999999863


No 14 
>PF00197 Kunitz_legume:  Trypsin and protease inhibitor;  InterPro: IPR002160 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The Kunitz-type soybean trypsin inhibitor (STI) family consists mainly of proteinase inhibitors from Leguminosae seeds []. They belong to MEROPS inhibitor family I3, clan IC. They exhibit proteinase inhibitory activity against serine proteinases; trypsin (MEROPS peptidase family S1, IPR001254 from INTERPRO) and subtilisin (MEROPS peptidase family S8, IPR000209 from INTERPRO), thiol proteinases (MEROPS peptidase family C1, IPR000668 from INTERPRO) and aspartic proteinases (MEROPS peptidase family A1, IPR001461 from INTERPRO) [].  Inhibitors from cereals are active against subtilisin and endogenous alpha-amylases, while some also inhibit tissue plasminogen activator. The inhibitors are usually specific for either trypsin or chymotrypsin, and some are effective against both. They are thought to protect the seeds against consumption by animal predators, while at the same time existing as seed storage proteins themselves - all the actively inhibitory members contain 2 disulphide bridges. The existence of a member with no inhibitory activity, winged bean albumin 1, suggests that the inhibitors may have evolved from seed storage proteins. Proteins from the Kunitz family contain from 170 to 200 amino acid residues and one or two intra-chain disulphide bonds. The best conserved region is found in their N-terminal section. The crystal structures of soybean trypsin inhibitor (STI), trypsin inhibitor DE-3 from the Kaffir tree Erythrina caffra (ETI) [] and the bifunctional proteinase K/alpha-amylase inhibitor from wheat (PK13) have been solved, showing them to share the same 12-stranded beta-sheet structure as those of interleukin-1 and heparin-binding growth factors []. The beta-sheets are arranged in 3 similar lobes around a central axis, 6 strands forming an anti-parallel beta-barrel. Despite the structural similarity, STI shows no interleukin-1 bioactivity, presumably as a result of their primary sequence disparities. The active inhibitory site containing the scissile bond is located in the loop between beta-strands 4 and 5 in STI and ETI. The STIs belong to a superfamily that also contains the interleukin-1 proteins, heparin binding growth factors (HBGF) and histactophilin, all of which have very similar structures, but share no sequence similarity with the STI family.; GO: 0004866 endopeptidase inhibitor activity; PDB: 3TC2_B 3S8J_A 3S8K_A 1TIE_A 2GZB_A 3E8L_C 2IWT_B 3BX1_C 1AVA_D 3IIR_A ....
Probab=38.82  E-value=25  Score=27.45  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=14.7

Q ss_pred             CCCccCCCCeEEEeeCCC
Q 046004           54 PDFKLVGGNLYFLVPVPL   71 (157)
Q Consensus        54 ~d~~L~~G~~YfLlP~~~   71 (157)
                      .+++|++|.-||++|+..
T Consensus         6 ~G~~l~~g~~YyI~p~~~   23 (176)
T PF00197_consen    6 DGNPLRNGGEYYILPAIR   23 (176)
T ss_dssp             TSCB-BTTSEEEEEESST
T ss_pred             CCCCCcCCCCEEEEeCcc
Confidence            368899999999999865


No 15 
>PF14237 DUF4339:  Domain of unknown function (DUF4339)
Probab=34.97  E-value=15  Score=22.11  Aligned_cols=10  Identities=30%  Similarity=0.780  Sum_probs=6.1

Q ss_pred             CCCCCCcccc
Q 046004          140 GDNTKAWKPE  149 (157)
Q Consensus       140 ~~~~~~WrP~  149 (157)
                      +.+-..|+|+
T Consensus        36 ~~g~~~W~pl   45 (45)
T PF14237_consen   36 KEGMSDWKPL   45 (45)
T ss_pred             CCChhhceEC
Confidence            3444678874


No 16 
>PRK07696 sulfur carrier protein ThiS; Provisional
Probab=33.32  E-value=49  Score=21.61  Aligned_cols=22  Identities=23%  Similarity=0.456  Sum_probs=19.1

Q ss_pred             EecCCcEEEEeCC-CcHHHHHhh
Q 046004           15 MKTDGKILEYNQP-IRVQDVLAE   36 (157)
Q Consensus        15 ~~~dG~v~e~~~p-v~a~~vm~~   36 (157)
                      +..||+..++..+ .++++++..
T Consensus         3 I~vNG~~~~~~~~~~tv~~lL~~   25 (67)
T PRK07696          3 LKINGNQIEVPESVKTVAELLTH   25 (67)
T ss_pred             EEECCEEEEcCCCcccHHHHHHH
Confidence            5679999999987 789999975


No 17 
>PRK06437 hypothetical protein; Provisional
Probab=31.73  E-value=1.5e+02  Score=19.29  Aligned_cols=52  Identities=13%  Similarity=0.268  Sum_probs=32.0

Q ss_pred             EecCC---cEEEEeCCCcHHHHHhhc--C--CcEEeCCCCCccCCCCCCccCCCCeEEEeeC
Q 046004           15 MKTDG---KILEYNQPIRVQDVLAEF--S--GHAISDSLPEIRHLRPDFKLVGGNLYFLVPV   69 (157)
Q Consensus        15 ~~~dG---~v~e~~~pv~a~~vm~~~--P--gh~v~~s~~~~~~L~~d~~L~~G~~YfLlP~   69 (157)
                      |..||   +..++..+.++++++.+.  +  +.++.- .  -.+++++..|..|--.-++|.
T Consensus         5 ~~v~g~~~~~~~i~~~~tv~dLL~~Lgi~~~~vaV~v-N--g~iv~~~~~L~dgD~Veiv~~   63 (67)
T PRK06437          5 IRVKGHINKTIEIDHELTVNDIIKDLGLDEEEYVVIV-N--GSPVLEDHNVKKEDDVLILEV   63 (67)
T ss_pred             EEecCCcceEEEcCCCCcHHHHHHHcCCCCccEEEEE-C--CEECCCceEcCCCCEEEEEec
Confidence            55678   557788889999999863  2  122221 1  133457888887755555543


No 18 
>PF01402 RHH_1:  Ribbon-helix-helix protein, copG family;  InterPro: IPR002145 CopG, also known as RepA, is responsible for the regulation of plasmid copy number. It binds to the repAB promoter and controls synthesis of the plasmid replication initiator protein RepB. Many bacterial transcription regulation proteins bind DNA through a 'helix-turn-helix' motif, nevertheless CopG displays a fully defined HTH-motif structure that is involved not in DNA-binding, but in the maintenance of the intrinsic dimeric functional structure and cooperativity [, ].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2BJ3_B 2BJ8_A 2BJ1_A 2BJ9_A 2BJ7_B 1EA4_L 2CPG_C 1B01_B 2BA3_A 2K9I_B ....
Probab=31.66  E-value=1e+02  Score=17.34  Aligned_cols=31  Identities=19%  Similarity=0.334  Sum_probs=22.2

Q ss_pred             EEEEEeCHHHHHHH---HHhccCCHHHHHHHHHh
Q 046004          100 RIKLVISKQELEEL---LQKQGVSVKDMVSRIQS  130 (157)
Q Consensus       100 rvkl~i~k~~L~~l---l~~~~~s~e~~l~~l~~  130 (157)
                      |+.|.|+++..++|   -.+.|.|..+++..+..
T Consensus         1 Riti~l~~~~~~~l~~~a~~~g~s~s~~ir~ai~   34 (39)
T PF01402_consen    1 RITIRLPDELYERLDELAKELGRSRSELIREAIR   34 (39)
T ss_dssp             EEEEEEEHHHHHHHHHHHHHHTSSHHHHHHHHHH
T ss_pred             CeEEEeCHHHHHHHHHHHHHHCcCHHHHHHHHHH
Confidence            67788888766654   44668898888776654


No 19 
>PF00325 Crp:  Bacterial regulatory proteins, crp family;  InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. This family groups together a range of proteins, including anr, crp, clp, cysR, fixK, flp, fnr, fnrN, hlyX and ntcA [, ]. Within this family, the HTH motif is situated towards the C terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2OZ6_A 1CGP_B 2GZW_C 1O3T_B 3ROU_A 2CGP_A 3RDI_A 1I5Z_A 3IYD_H 3FWE_B ....
Probab=31.53  E-value=53  Score=18.80  Aligned_cols=28  Identities=14%  Similarity=0.405  Sum_probs=16.5

Q ss_pred             EEeCHHHHHHHHHhccCCHHHHHHHHHh
Q 046004          103 LVISKQELEELLQKQGVSVKDMVSRIQS  130 (157)
Q Consensus       103 l~i~k~~L~~ll~~~~~s~e~~l~~l~~  130 (157)
                      |.+|++|+..++.-.-.++-.+++.+.+
T Consensus         1 l~mtr~diA~~lG~t~ETVSR~l~~l~~   28 (32)
T PF00325_consen    1 LPMTRQDIADYLGLTRETVSRILKKLER   28 (32)
T ss_dssp             EE--HHHHHHHHTS-HHHHHHHHHHHHH
T ss_pred             CCcCHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            5689999999987543345555555554


No 20 
>smart00452 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors.
Probab=30.23  E-value=39  Score=26.36  Aligned_cols=18  Identities=22%  Similarity=0.449  Sum_probs=15.8

Q ss_pred             CCCccCCCCeEEEeeCCC
Q 046004           54 PDFKLVGGNLYFLVPVPL   71 (157)
Q Consensus        54 ~d~~L~~G~~YfLlP~~~   71 (157)
                      .+++|++|.-||++|+..
T Consensus         5 ~G~~l~~G~~YyI~p~~~   22 (172)
T smart00452        5 DGNPLRNGGTYYILPAIR   22 (172)
T ss_pred             CCCCCcCCCcEEEEEccc
Confidence            468999999999999964


No 21 
>PF10723 RepB-RCR_reg:  Replication regulatory protein RepB;  InterPro: IPR019661  This family of proteins regulates the replication of rolling circle replication (RCR) plasmids that have a double-strand replication origin (dso). Regulation of the replication of the RCR plasmids occurs mainly at the initiation of leading strand synthesis at the dso, such that concentration of Rep protein controls plasmid replication []. ; PDB: 2KEL_B.
Probab=28.93  E-value=1.6e+02  Score=20.33  Aligned_cols=36  Identities=33%  Similarity=0.544  Sum_probs=25.1

Q ss_pred             CceEEEEEEeC---HHHHHHHHHhccCCHHHHHHHHHhh
Q 046004           96 GGVVRIKLVIS---KQELEELLQKQGVSVKDMVSRIQSK  131 (157)
Q Consensus        96 ~g~~rvkl~i~---k~~L~~ll~~~~~s~e~~l~~l~~~  131 (157)
                      .+..++++.|+   |+.|.+|..+.|++.-+++..|+..
T Consensus        39 ~t~k~i~v~I~~~~K~~L~~lc~~~GlTQae~IE~LI~~   77 (84)
T PF10723_consen   39 ETHKRINVFIPNELKERLEELCKEQGLTQAEMIERLIKS   77 (84)
T ss_dssp             --EEEEEEEEEHHHHHHHHHHHHHS---HHHHHHHHHHH
T ss_pred             hhcCeeEEEECHHHHHHHHHHHHHcCCcHHHHHHHHHHH
Confidence            34578999998   4577777788899999999888764


No 22 
>PHA02843 hypothetical protein; Provisional
Probab=28.49  E-value=23  Score=23.41  Aligned_cols=14  Identities=50%  Similarity=0.733  Sum_probs=9.8

Q ss_pred             CCCccccCCceeEE
Q 046004            1 MGNCLVLEEKVIKV   14 (157)
Q Consensus         1 MGNC~~~~~~~ikV   14 (157)
                      ||||.-.+.+.||-
T Consensus         1 mgncsrkqnknikt   14 (73)
T PHA02843          1 MGNCSRKQNKNIKT   14 (73)
T ss_pred             CCccchhhccCccc
Confidence            89998766665553


No 23 
>PRK06488 sulfur carrier protein ThiS; Validated
Probab=24.56  E-value=83  Score=20.02  Aligned_cols=22  Identities=23%  Similarity=0.385  Sum_probs=18.2

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+..++ .+.++.+++...
T Consensus         3 i~~Ng~~~~~-~~~tl~~Ll~~l   24 (65)
T PRK06488          3 LFVNGETLQT-EATTLALLLAEL   24 (65)
T ss_pred             EEECCeEEEc-CcCcHHHHHHHc
Confidence            5679999999 568999999763


No 24 
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein.
Probab=23.63  E-value=1e+02  Score=17.51  Aligned_cols=34  Identities=26%  Similarity=0.520  Sum_probs=26.9

Q ss_pred             EEEEEEeCHHHHHHHHHhccCCHHHHHHHHHhhc
Q 046004           99 VRIKLVISKQELEELLQKQGVSVKDMVSRIQSKQ  132 (157)
Q Consensus        99 ~rvkl~i~k~~L~~ll~~~~~s~e~~l~~l~~~~  132 (157)
                      +++.+.+|..+|.+.+.-...++.+.+..|....
T Consensus         3 ~~~~~~~s~~~la~~l~~s~~tv~~~l~~L~~~g   36 (48)
T smart00419        3 IRVRLPLTRQEIAELLGLTRETVSRTLKRLEKEG   36 (48)
T ss_pred             ceEEeccCHHHHHHHHCCCHHHHHHHHHHHHHCC
Confidence            5677889999999999865567788888887754


No 25 
>cd02980 TRX_Fd_family Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd) family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like Fds) and proteins containing domains similar to TRX-like Fd including formate dehydrogenases, NAD-reducing hydrogenases and the subunit E of NADH:ubiquinone oxidoreductase (NuoE). TRX-like Fds are soluble low-potential electron carriers containing a single [2Fe-2S] cluster. The exact role of TRX-like Fd is still unclear. It has been suggested that it may be involved in nitrogen fixation. Its homologous domains in large redox enzymes (such as Nuo and hydrogenases) function as electron carriers.
Probab=23.46  E-value=88  Score=20.07  Aligned_cols=33  Identities=24%  Similarity=0.400  Sum_probs=15.6

Q ss_pred             CCCccccCCceeEEEecCCcEEEEeCCCcHHHHHhh
Q 046004            1 MGNCLVLEEKVIKVMKTDGKILEYNQPIRVQDVLAE   36 (157)
Q Consensus         1 MGNC~~~~~~~ikV~~~dG~v~e~~~pv~a~~vm~~   36 (157)
                      ||+|-   ...+-+|.++|.+...-.|-.+.+|+.+
T Consensus        44 lg~C~---~~P~v~i~~~~~~y~~v~~~~~~~il~~   76 (77)
T cd02980          44 LGACG---LAPVVVVYPDGVWYGRVTPEDVEEIVEE   76 (77)
T ss_pred             cCccc---CCCEEEEeCCCeEEccCCHHHHHHHHHh
Confidence            45553   3444555566654433344444445543


No 26 
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism]
Probab=22.64  E-value=98  Score=20.59  Aligned_cols=23  Identities=30%  Similarity=0.515  Sum_probs=20.2

Q ss_pred             EecCCcEEEEeCCCcHHHHHhhc
Q 046004           15 MKTDGKILEYNQPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~~pv~a~~vm~~~   37 (157)
                      +..||+-.++..+.|++++|.+.
T Consensus         5 i~~ng~~~e~~~~~tv~dLL~~l   27 (68)
T COG2104           5 IQLNGKEVEIAEGTTVADLLAQL   27 (68)
T ss_pred             EEECCEEEEcCCCCcHHHHHHHh
Confidence            45689999999999999999884


No 27 
>PRK08364 sulfur carrier protein ThiS; Provisional
Probab=21.85  E-value=2.4e+02  Score=18.31  Aligned_cols=52  Identities=19%  Similarity=0.299  Sum_probs=32.3

Q ss_pred             EecCCc----EEEEeCCCcHHHHHhhcC----CcEEeCCCCCccCCCCCCccCCCCeEEEeeC
Q 046004           15 MKTDGK----ILEYNQPIRVQDVLAEFS----GHAISDSLPEIRHLRPDFKLVGGNLYFLVPV   69 (157)
Q Consensus        15 ~~~dG~----v~e~~~pv~a~~vm~~~P----gh~v~~s~~~~~~L~~d~~L~~G~~YfLlP~   69 (157)
                      +..+|+    ..++....++++++.+.-    +.+|.--.   ..++++..|+.|--.-++|.
T Consensus         7 v~vng~~~~~~~~~~~~~tv~~ll~~l~~~~~~v~v~vNg---~iv~~~~~l~~gD~Veii~~   66 (70)
T PRK08364          7 VKVIGRGIEKEIEWRKGMKVADILRAVGFNTESAIAKVNG---KVALEDDPVKDGDYVEVIPV   66 (70)
T ss_pred             EEEeccccceEEEcCCCCcHHHHHHHcCCCCccEEEEECC---EECCCCcCcCCCCEEEEEcc
Confidence            344777    666778899999998642    11221111   23457788888876666664


No 28 
>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c
Probab=20.86  E-value=1.3e+02  Score=21.13  Aligned_cols=24  Identities=25%  Similarity=0.404  Sum_probs=17.0

Q ss_pred             CceeEEEecCCcEEEEeCCCcHHHHH
Q 046004            9 EKVIKVMKTDGKILEYNQPIRVQDVL   34 (157)
Q Consensus         9 ~~~ikV~~~dG~v~e~~~pv~a~~vm   34 (157)
                      ...+.|+.++|+  -||..|+..++=
T Consensus        48 ePlV~V~~p~g~--v~Y~~V~~edv~   71 (92)
T cd03063          48 EPLVEVETPGGR--VAYGPVTPADVA   71 (92)
T ss_pred             CCEEEEEeCCCc--EEEEeCCHHHHH
Confidence            455677779887  568888877743


No 29 
>PF03990 DUF348:  Domain of unknown function (DUF348)     ;  InterPro: IPR007137 This domain normally occurs as tandem repeats; however it is found as a single copy in the Saccharomyces cerevisiae (Baker's yeast) DNA-binding nuclear protein YCR593 (P25357 from SWISSPROT).
Probab=20.41  E-value=1.6e+02  Score=17.31  Aligned_cols=23  Identities=30%  Similarity=0.342  Sum_probs=18.4

Q ss_pred             EecCCcEEEEe-CCCcHHHHHhhc
Q 046004           15 MKTDGKILEYN-QPIRVQDVLAEF   37 (157)
Q Consensus        15 ~~~dG~v~e~~-~pv~a~~vm~~~   37 (157)
                      +..||+...++ ..-+|+++|.+.
T Consensus         4 v~~dG~~~~v~T~a~tV~~~L~~~   27 (43)
T PF03990_consen    4 VTVDGKEKTVYTTASTVGDALKEL   27 (43)
T ss_pred             EEECCEEEEEEeCCCCHHHHHHhC
Confidence            34599888886 688999999875


Done!