BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046032
         (464 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BZN|A Chain A, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|B Chain B, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|C Chain C, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|D Chain D, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|E Chain E, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|F Chain F, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|G Chain G, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|H Chain H, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2C6Q|A Chain A, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|B Chain B, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|C Chain C, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|D Chain D, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|E Chain E, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|F Chain F, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|G Chain G, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|H Chain H, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
          Length = 351

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 226 EIRRKTESGQDPEINDPEVGTIKIPNFEYDLEADIR---KGLRKLFSAKGDCTLKEMDTN 282
           E+  K  +G   E    E  T+++P F+ D+E  IR    G+R   +  G   LKE+   
Sbjct: 282 EMAMKKYAGGVAEYRASEGKTVEVP-FKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRR 340

Query: 283 CDLIQFVEKVN 293
              I+  ++VN
Sbjct: 341 TTFIRVTQQVN 351


>pdb|2A7R|A Chain A, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
 pdb|2A7R|B Chain B, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
 pdb|2A7R|C Chain C, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
 pdb|2A7R|D Chain D, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
          Length = 366

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 226 EIRRKTESGQDPEINDPEVGTIKIPNFEYDLEADIR---KGLRKLFSAKGDCTLKEMDTN 282
           E+  K  +G   E    E  T+++P F+ D+E  IR    G+R   +  G   LKE+   
Sbjct: 290 EMAMKKYAGGVAEYRASEGKTVEVP-FKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRR 348

Query: 283 CDLIQFVEKVN 293
              I+  ++VN
Sbjct: 349 TTFIRVTQQVN 359


>pdb|1XFD|A Chain A, Structure Of A Human A-Type Potassium Channel Accelerating
           Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase
           Family
 pdb|1XFD|B Chain B, Structure Of A Human A-Type Potassium Channel Accelerating
           Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase
           Family
 pdb|1XFD|C Chain C, Structure Of A Human A-Type Potassium Channel Accelerating
           Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase
           Family
 pdb|1XFD|D Chain D, Structure Of A Human A-Type Potassium Channel Accelerating
           Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase
           Family
          Length = 723

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 20/102 (19%)

Query: 265 RKLFSAKGDCTLKEMDTNCDLIQFVEKVNFSFGKSIIFWHIATE-------FLYEKTAKE 317
           R+L+SA           +CDL++     + SF  S+ F+ +  E        ++  T K+
Sbjct: 386 RQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKK 445

Query: 318 AISDEET-------YNAREFSKI------LSDYMLYLLVLKP 346
            + D ET        N R+  K+      + DY L + +LKP
Sbjct: 446 KMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKP 487


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,364,831
Number of Sequences: 62578
Number of extensions: 530165
Number of successful extensions: 1132
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1128
Number of HSP's gapped (non-prelim): 6
length of query: 464
length of database: 14,973,337
effective HSP length: 102
effective length of query: 362
effective length of database: 8,590,381
effective search space: 3109717922
effective search space used: 3109717922
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)