Query         046034
Match_columns 64
No_of_seqs    104 out of 576
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 08:06:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046034.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046034hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3361 Iron binding protein i  99.7 7.9E-17 1.7E-21  109.1   5.2   50    1-50    106-155 (157)
  2 PRK11325 scaffold protein; Pro  99.3 3.1E-12 6.8E-17   82.8   5.3   46    2-47     81-126 (127)
  3 TIGR01999 iscU FeS cluster ass  99.3 3.9E-12 8.5E-17   81.8   5.0   45    2-46     79-123 (124)
  4 TIGR03419 NifU_clost FeS clust  99.2 1.4E-11   3E-16   79.1   4.6   46    2-47     75-121 (121)
  5 PF01592 NifU_N:  NifU-like N t  99.0 4.7E-10   1E-14   71.9   4.2   45    2-46     79-124 (126)
  6 TIGR02000 NifU_proper Fe-S clu  99.0 5.9E-10 1.3E-14   80.9   4.4   47    2-48     80-127 (290)
  7 COG0822 IscU NifU homolog invo  98.7 1.3E-08 2.7E-13   68.2   2.8   47    2-48     82-147 (150)
  8 cd06664 IscU_like Iron-sulfur   97.8 1.9E-05 4.1E-10   49.7   2.5   37    2-38     76-123 (123)
  9 TIGR01994 SUF_scaf_2 SUF syste  92.8    0.15 3.3E-06   33.2   3.2   21   20-40    117-137 (137)
 10 PF13075 DUF3939:  Protein of u  72.8       6 0.00013   26.9   3.4   47    5-51     38-99  (140)
 11 TIGR02947 SigH_actino RNA poly  72.3      13 0.00027   24.2   4.9   39    7-45    146-185 (193)
 12 PF00325 Crp:  Bacterial regula  70.5     9.8 0.00021   19.6   3.2   27    8-44      2-28  (32)
 13 PF14131 DUF4298:  Domain of un  69.4     2.7 5.8E-05   25.8   1.1   27   19-45     55-81  (90)
 14 TIGR03121 one_C_dehyd_A formyl  67.7     1.6 3.5E-05   34.9  -0.2   26    7-32    207-240 (556)
 15 PF08383 Maf_N:  Maf N-terminal  65.7     4.8  0.0001   21.6   1.5   16    3-18     17-32  (35)
 16 PRK12519 RNA polymerase sigma   64.3      18 0.00039   23.4   4.3   37    7-43    156-193 (194)
 17 PF12918 TcdB_N:  TcdB toxin N-  62.4      21 0.00045   20.9   4.0   41    8-48      4-45  (66)
 18 PF04539 Sigma70_r3:  Sigma-70   61.1     4.5 9.7E-05   22.9   0.9   18    9-26     21-38  (78)
 19 PRK12512 RNA polymerase sigma   59.6      22 0.00049   22.7   4.1   37    7-49    146-182 (184)
 20 PF10470 AKAP7_RIRII_bdg:  PKA-  57.7      16 0.00034   21.7   2.8   27   29-55     15-41  (61)
 21 PF10668 Phage_terminase:  Phag  57.4     6.8 0.00015   22.9   1.2   17    8-24     22-38  (60)
 22 PRK11923 algU RNA polymerase s  54.2      27 0.00059   22.5   3.8   38    7-44    153-191 (193)
 23 PF06926 Rep_Org_C:  Putative r  51.7      31 0.00067   22.1   3.6   37   13-52     25-61  (95)
 24 PF12244 DUF3606:  Protein of u  48.4      13 0.00029   21.0   1.5   31   15-45     27-57  (57)
 25 cd01304 FMDH_A Formylmethanofu  48.2     5.8 0.00012   31.8  -0.1   26    7-32    203-236 (541)
 26 PF13735 tRNA_NucTran2_2:  tRNA  45.3      15 0.00032   23.1   1.5   19    7-25    103-121 (149)
 27 PF04545 Sigma70_r4:  Sigma-70,  44.0      48   0.001   17.2   3.3   19    8-26     20-38  (50)
 28 PF14791 DNA_pol_B_thumb:  DNA   42.8      15 0.00033   21.2   1.2   19    9-27     43-64  (64)
 29 PRK12532 RNA polymerase sigma   42.4      68  0.0015   20.7   4.4   37    7-43    151-188 (195)
 30 PF06056 Terminase_5:  Putative  41.8      22 0.00047   20.2   1.7   15    8-22     13-27  (58)
 31 PRK02919 oxaloacetate decarbox  39.7      25 0.00053   21.5   1.8   14   34-47     69-82  (82)
 32 TIGR01764 excise DNA binding d  39.6      22 0.00047   17.6   1.4   15    9-23      2-16  (49)
 33 cd08804 Death_ank2 Death domai  39.5      84  0.0018   18.7   4.6   43    5-47     12-59  (84)
 34 PRK12520 RNA polymerase sigma   39.3      40 0.00088   21.7   2.9   20    7-26    146-165 (191)
 35 PF12728 HTH_17:  Helix-turn-he  38.6      22 0.00047   18.6   1.3   12   10-21      3-14  (51)
 36 PRK12513 RNA polymerase sigma   38.3      70  0.0015   20.6   3.9   20    7-26    154-173 (194)
 37 PF10078 DUF2316:  Uncharacteri  37.4      30 0.00066   21.6   2.0   25    2-26     17-41  (89)
 38 PRK07037 extracytoplasmic-func  37.0      73  0.0016   19.7   3.7   32    7-44    124-155 (163)
 39 PRK05803 sporulation sigma fac  36.3      70  0.0015   21.6   3.8   33    8-40    195-228 (233)
 40 PRK12522 RNA polymerase sigma   36.0      95  0.0021   19.6   4.2   20    7-26    134-153 (173)
 41 TIGR02937 sigma70-ECF RNA poly  35.6      83  0.0018   18.2   3.6   20    7-26    125-144 (158)
 42 cd06171 Sigma70_r4 Sigma70, re  35.5      29 0.00062   16.9   1.4   18    7-24     25-42  (55)
 43 PRK05602 RNA polymerase sigma   35.4      79  0.0017   20.2   3.8   20    7-26    143-162 (186)
 44 PRK09652 RNA polymerase sigma   34.6      91   0.002   19.3   3.9   20    7-26    143-162 (182)
 45 KOG0870 DNA polymerase epsilon  34.2      40 0.00086   23.7   2.3   34    8-47     65-99  (172)
 46 PRK11924 RNA polymerase sigma   34.2      69  0.0015   19.7   3.3   19    7-25    140-158 (179)
 47 PRK06811 RNA polymerase factor  34.1      96  0.0021   20.0   4.1   34    7-46    146-179 (189)
 48 PRK10030 hypothetical protein;  33.9      25 0.00054   24.2   1.3   20   20-39    121-140 (197)
 49 TIGR02950 SigM_subfam RNA poly  33.1   1E+02  0.0023   18.7   3.9   20    7-26    120-139 (154)
 50 PRK12536 RNA polymerase sigma   33.1      98  0.0021   19.8   4.0   19    7-25    144-162 (181)
 51 PF11387 DUF2795:  Protein of u  32.7      20 0.00043   19.3   0.5   16   11-26     23-39  (44)
 52 PF00531 Death:  Death domain;   32.4      93   0.002   17.2   3.8   39    7-45     11-53  (83)
 53 cd08318 Death_NMPP84 Death dom  32.4 1.1E+02  0.0024   18.1   4.0   42    7-48     17-62  (86)
 54 PRK12530 RNA polymerase sigma   32.3 1.1E+02  0.0024   19.8   4.2   20    7-26    149-168 (189)
 55 PRK08583 RNA polymerase sigma   32.0      79  0.0017   21.7   3.5   20    7-26    220-239 (257)
 56 PRK09645 RNA polymerase sigma   31.9      95  0.0021   19.5   3.7   20    7-26    133-152 (173)
 57 PRK12535 RNA polymerase sigma   31.2      78  0.0017   20.9   3.3   38    7-44    148-186 (196)
 58 PHA01623 hypothetical protein   31.0      57  0.0012   18.4   2.3   15   32-46     40-54  (56)
 59 PRK09647 RNA polymerase sigma   30.9      81  0.0018   21.1   3.4   32    7-44    153-184 (203)
 60 cd08311 Death_p75NR Death doma  30.2      91   0.002   18.5   3.2   37    9-45     16-52  (77)
 61 PRK08295 RNA polymerase factor  30.1      91   0.002   20.1   3.4   31    7-43    169-199 (208)
 62 cd04752 Commd4 COMM_Domain con  29.4      93   0.002   20.8   3.5   17    8-24     59-78  (174)
 63 PF08281 Sigma70_r4_2:  Sigma-7  29.2      32 0.00069   18.0   1.0   19    7-25     25-43  (54)
 64 smart00550 Zalpha Z-DNA-bindin  28.6      43 0.00093   19.0   1.5   15    9-23     23-37  (68)
 65 TIGR02984 Sig-70_plancto1 RNA   28.5   1E+02  0.0022   19.4   3.4   19    8-26    156-174 (189)
 66 PRK07204 3-oxoacyl-(acyl carri  28.1      87  0.0019   22.0   3.3   18   25-42     50-67  (329)
 67 PF07759 DUF1615:  Protein of u  28.1      23  0.0005   27.0   0.4   21   12-32     11-35  (319)
 68 TIGR03070 couple_hipB transcri  28.1      53  0.0012   16.7   1.7   17    5-21     12-28  (58)
 69 PF09339 HTH_IclR:  IclR helix-  28.1      23 0.00049   18.9   0.3   18    9-26     19-36  (52)
 70 smart00530 HTH_XRE Helix-turn-  28.0      59  0.0013   15.2   1.8   20    5-24      7-26  (56)
 71 PF14451 Ub-Mut7C:  Mut7-C ubiq  28.0      32 0.00069   20.8   0.9   17   10-26     34-50  (81)
 72 TIGR02859 spore_sigH RNA polym  27.8 1.4E+02   0.003   19.0   4.0   17    8-24    165-181 (198)
 73 PRK12514 RNA polymerase sigma   27.5 1.6E+02  0.0035   18.6   4.2   19    7-25    144-162 (179)
 74 PRK03814 oxaloacetate decarbox  27.3      58  0.0013   20.0   2.0   15   32-46     69-83  (85)
 75 PRK12527 RNA polymerase sigma   26.7 1.3E+02  0.0029   18.6   3.6   20    7-26    120-139 (159)
 76 PRK14384 hypothetical protein;  26.1      59  0.0013   18.9   1.8   12   26-37      9-20  (56)
 77 PRK12531 RNA polymerase sigma   25.7 1.4E+02  0.0031   19.3   3.8   18    8-25    157-174 (194)
 78 PF09077 Phage-MuB_C:  Mu B tra  25.6      40 0.00086   20.6   1.0   20    2-21     19-39  (78)
 79 CHL00203 fabH 3-oxoacyl-acyl-c  25.5      93   0.002   22.0   3.1   17   26-42     50-66  (326)
 80 PRK14382 hypothetical protein;  25.5      59  0.0013   19.3   1.8   13   25-37     28-40  (68)
 81 PF11212 DUF2999:  Protein of u  25.5      31 0.00068   21.5   0.6   16   13-28     34-49  (82)
 82 PF04564 U-box:  U-box domain;   25.3      76  0.0017   18.1   2.2   16   32-47     57-72  (73)
 83 cd08777 Death_RIP1 Death Domai  25.1 1.6E+02  0.0035   17.6   4.5   43    5-47     10-58  (86)
 84 PRK09047 RNA polymerase factor  25.1 1.4E+02  0.0031   18.2   3.6   20    7-26    121-140 (161)
 85 PHA01976 helix-turn-helix prot  25.1      62  0.0013   17.5   1.7   18    5-22     12-29  (67)
 86 PF03131 bZIP_Maf:  bZIP Maf tr  24.8      49  0.0011   19.9   1.3   28    1-28      1-29  (92)
 87 TIGR00673 cynS cyanate hydrata  24.7      59  0.0013   22.1   1.9   27    5-31     18-44  (150)
 88 smart00005 DEATH DEATH domain,  24.5 1.4E+02  0.0031   16.8   3.3   41    8-48     17-62  (88)
 89 PF08513 LisH:  LisH;  InterPro  24.5      82  0.0018   15.1   1.9   15   35-49      3-17  (27)
 90 PF01978 TrmB:  Sugar-specific   24.5      30 0.00066   19.1   0.4   18    8-25     22-39  (68)
 91 TIGR02985 Sig70_bacteroi1 RNA   24.0 1.5E+02  0.0032   17.8   3.4   18    8-25    129-146 (161)
 92 PF04967 HTH_10:  HTH DNA bindi  23.8 1.3E+02  0.0029   16.8   3.0   19    7-25     22-40  (53)
 93 COG1229 FwdA Formylmethanofura  23.6      29 0.00064   28.1   0.2   26    7-32    210-243 (575)
 94 PRK09648 RNA polymerase sigma   23.6 1.5E+02  0.0033   18.9   3.6   19    8-26    155-173 (189)
 95 TIGR02835 spore_sigmaE RNA pol  23.6 1.4E+02   0.003   20.2   3.6   18    8-25    198-215 (234)
 96 PF00666 Cathelicidins:  Cathel  23.5      88  0.0019   18.6   2.2   19   32-50      5-23  (67)
 97 TIGR02983 SigE-fam_strep RNA p  23.5 1.9E+02  0.0041   17.8   3.9   18    7-24    125-142 (162)
 98 TIGR02948 SigW_bacill RNA poly  23.4 1.6E+02  0.0035   18.5   3.6   20    7-26    151-170 (187)
 99 PRK12547 RNA polymerase sigma   23.4 1.8E+02  0.0039   18.2   3.9   19    7-25    127-145 (164)
100 PF14106 DUF4279:  Domain of un  23.2      44 0.00095   20.1   0.9   19    8-26      5-23  (118)
101 TIGR02846 spore_sigmaK RNA pol  23.1 1.3E+02  0.0029   20.2   3.4   19    8-26    194-212 (227)
102 PRK09642 RNA polymerase sigma   23.1 1.9E+02  0.0042   17.8   4.0   19    7-25    121-139 (160)
103 PRK12543 RNA polymerase sigma   22.9 1.9E+02  0.0041   18.4   3.9   20    7-26    132-151 (179)
104 PRK10046 dpiA two-component re  22.8      77  0.0017   20.8   2.1   24    8-31    177-202 (225)
105 PRK14390 hypothetical protein;  22.8      73  0.0016   18.7   1.8   13   25-37     21-33  (63)
106 PRK12526 RNA polymerase sigma   22.7 1.7E+02  0.0037   19.3   3.8   30    8-43    169-198 (206)
107 TIGR02939 RpoE_Sigma70 RNA pol  22.7 1.6E+02  0.0034   18.6   3.5   20    7-26    153-172 (190)
108 PRK04217 hypothetical protein;  22.7 1.8E+02  0.0039   18.5   3.7   36    7-42     57-93  (110)
109 cd00336 Ribosomal_L22 Ribosoma  22.5      71  0.0015   19.4   1.8   39   10-48     23-62  (105)
110 PRK09641 RNA polymerase sigma   22.5 1.6E+02  0.0034   18.5   3.5   19    7-25    151-169 (187)
111 smart00421 HTH_LUXR helix_turn  22.4      69  0.0015   15.8   1.5   19    7-25     17-35  (58)
112 TIGR01195 oadG_fam sodium pump  22.3      71  0.0015   19.2   1.7   14   33-46     68-81  (82)
113 PRK09640 RNA polymerase sigma   22.3   2E+02  0.0042   18.5   3.9   20    7-26    149-168 (188)
114 PRK11470 hypothetical protein;  22.3      75  0.0016   22.4   2.0   25   20-44    111-135 (200)
115 PRK12533 RNA polymerase sigma   22.1 1.6E+02  0.0035   20.0   3.7   19    7-25    149-167 (216)
116 TIGR03879 near_KaiC_dom probab  22.0      64  0.0014   19.4   1.4   19    7-25     31-49  (73)
117 TIGR03209 P21_Cbot clostridium  22.0      62  0.0013   19.8   1.4   18    7-24    122-139 (142)
118 COG1595 RpoE DNA-directed RNA   22.0 1.8E+02  0.0039   18.6   3.7   32    7-44    142-173 (182)
119 PF07308 DUF1456:  Protein of u  22.0 1.4E+02  0.0031   17.4   2.9   20    5-24     10-32  (68)
120 PF06531 DUF1108:  Protein of u  22.0 1.2E+02  0.0026   19.1   2.7   24   26-49     52-75  (86)
121 PRK14373 hypothetical protein;  21.8      77  0.0017   19.1   1.8   13   25-37     32-44  (73)
122 PRK12528 RNA polymerase sigma   21.7 1.2E+02  0.0025   18.9   2.7   17    8-24    129-145 (161)
123 PRK10840 transcriptional regul  21.7 1.2E+02  0.0025   19.6   2.7   21    7-27    164-186 (216)
124 PF07022 Phage_CI_repr:  Bacter  21.6      26 0.00057   19.7  -0.3   19    4-22      7-26  (66)
125 PRK02866 cyanate hydratase; Va  21.5      75  0.0016   21.5   1.9   27    5-31     15-41  (147)
126 cd00093 HTH_XRE Helix-turn-hel  21.3      95  0.0021   14.5   1.8   20    5-24      9-28  (58)
127 TIGR02999 Sig-70_X6 RNA polyme  21.3      65  0.0014   20.4   1.5   20    7-26    149-168 (183)
128 COG3413 Predicted DNA binding   21.2 1.3E+02  0.0028   20.3   3.0   20    7-26    177-196 (215)
129 PF14813 NADH_B2:  NADH dehydro  21.1      45 0.00098   20.1   0.6    9   16-24     61-69  (71)
130 PLN03168 chalcone synthase; Pr  21.0      84  0.0018   23.5   2.2   17   12-28    310-326 (389)
131 PRK12524 RNA polymerase sigma   21.0 1.7E+02  0.0036   19.0   3.4   32    7-44    151-182 (196)
132 TIGR02960 SigX5 RNA polymerase  20.9 2.2E+02  0.0048   19.8   4.2   20    6-25    156-175 (324)
133 PRK09636 RNA polymerase sigma   20.8   3E+02  0.0066   19.2   5.0   21    5-25    128-148 (293)
134 PRK08301 sporulation sigma fac  20.8 1.9E+02   0.004   19.4   3.7   18    8-25    198-215 (234)
135 PRK12539 RNA polymerase sigma   20.7 2.2E+02  0.0047   18.2   3.9   19    7-25    146-164 (184)
136 PRK14375 hypothetical protein;  20.5      85  0.0018   18.8   1.8   13   25-37     22-34  (70)
137 PF08334 T2SG:  Type II secreti  20.5 1.7E+02  0.0038   17.6   3.2   24   28-51     14-37  (108)
138 COG0759 Uncharacterized conser  20.5      81  0.0018   20.0   1.7   13   25-37     33-45  (92)
139 PF14698 ASL_C2:  Argininosucci  20.3      57  0.0012   18.9   1.0   18    9-26      2-22  (70)
140 PRK12523 RNA polymerase sigma   20.3 2.4E+02  0.0051   17.8   4.0   18    8-25    135-152 (172)
141 PRK09258 3-oxoacyl-(acyl carri  20.3 1.3E+02  0.0029   21.1   3.0   34   12-45    273-311 (338)
142 PRK11753 DNA-binding transcrip  20.2   2E+02  0.0044   18.3   3.7   29    7-45    167-195 (211)
143 cd04761 HTH_MerR-SF Helix-Turn  20.1      73  0.0016   15.9   1.3   13   10-22      2-14  (49)
144 cd04762 HTH_MerR-trunc Helix-T  20.1      77  0.0017   15.3   1.3   11   11-21      3-13  (49)

No 1  
>KOG3361 consensus Iron binding protein involved in Fe-S cluster formation [Energy production and conversion]
Probab=99.67  E-value=7.9e-17  Score=109.06  Aligned_cols=50  Identities=62%  Similarity=0.819  Sum_probs=46.9

Q ss_pred             ChhHHhhcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhhCCCc
Q 046034            1 MANLRNLSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKHTKSS   50 (64)
Q Consensus         1 ~~~~EA~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k~~~~~   50 (64)
                      |.++|+++|++.+|+.+|.|||.|+|||+||++|++.||+||+.||...+
T Consensus       106 kt~dea~kIkNteIAKeL~LPPVKLHCSMLAEDAIKaAikdyk~Kq~~~~  155 (157)
T KOG3361|consen  106 KTLDEALKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKEKQNKPN  155 (157)
T ss_pred             ccHHHHHhcccHHHHHhccCCchhhhhHHHHHHHHHHHHHHHHHhccCCC
Confidence            56899999999999999999999999999999999999999999987554


No 2  
>PRK11325 scaffold protein; Provisional
Probab=99.32  E-value=3.1e-12  Score=82.78  Aligned_cols=46  Identities=52%  Similarity=0.807  Sum_probs=43.4

Q ss_pred             hhHHhhcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhhC
Q 046034            2 ANLRNLSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKHT   47 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k~~   47 (64)
                      .++|++.|+.++|.++|||||.|+||+.|+.+||++||.+|+.++.
T Consensus        81 tl~ea~~i~~~~i~~~lg~p~~r~~CA~la~~al~~a~~~y~~~~~  126 (127)
T PRK11325         81 TLDEALAIKNTDIAEELALPPVKIHCSILAEDAIKAAIADYKSKQA  126 (127)
T ss_pred             CHHHHHhcCHHHHHHHcCCCcccchHHHHHHHHHHHHHHHHHhhcC
Confidence            4789999999999999999999999999999999999999988764


No 3  
>TIGR01999 iscU FeS cluster assembly scaffold IscU. This model represents IscU, a homolog of the N-terminal region of NifU, an Fe-S cluster assembly protein found mostly in nitrogen-fixing bacteria. IscU is considered part of the IscSUA-hscAB-fdx system of Fe-S assembly, whereas NifU is found in nitrogenase-containing (nitrogen-fixing) species. A NifU-type protein is also found in Helicobacter and Campylobacter. IscU and NifU are considered scaffold proteins on which Fe-S clusters are assembled before transfer to apoproteins. This model excludes true NifU proteins as in Klebsiella pneumoniae and Anabaena sp. as well as archaeal homologs. It includes largely proteobacterial and eukaryotic forms.
Probab=99.30  E-value=3.9e-12  Score=81.80  Aligned_cols=45  Identities=64%  Similarity=0.893  Sum_probs=42.6

Q ss_pred             hhHHhhcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhh
Q 046034            2 ANLRNLSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKH   46 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k~   46 (64)
                      .++|+..|++++|.++|||||.|+||+.|+.+||+.||.+|+.++
T Consensus        79 tl~ea~~i~~~~i~~~lg~p~~r~~CA~l~~~al~~a~~~y~~~~  123 (124)
T TIGR01999        79 SLEEALKIKNTEIAKELSLPPVKLHCSLLAEDAIKAAIKDYKSKQ  123 (124)
T ss_pred             CHHHHHhccHHHHHHHcCCCcccchHHHHHHHHHHHHHHHHHHhc
Confidence            478999999999999999999999999999999999999998765


No 4  
>TIGR03419 NifU_clost FeS cluster assembly scaffold protein NifU, Clostridium type. NifU and NifS form a pair of iron-sulfur (FeS) cluster biosynthesis proteins much simpler than the ISC and SUF systems. Members of this protein family are a distinct group of NifU-like proteins, found always to a NifS-like protein and restricted to species that lack a SUF system. Typically, NIF systems service a smaller number of FeS-containing proteins than do ISC or SUF. Members of this particular branch typically are found, almost half the time, near the mnmA gene, involved in the carboxymethylaminomethyl modification of U34 in some tRNAs (see GenProp0704). While other NifU proteins are associated with nitrogen fixation, this family is not.
Probab=99.23  E-value=1.4e-11  Score=79.10  Aligned_cols=46  Identities=43%  Similarity=0.687  Sum_probs=42.9

Q ss_pred             hhHHhhcCCHHHHHHhc-CCCCchhHHHHHHHHHHHHHHHHHHHhhC
Q 046034            2 ANLRNLSGLSKEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKHT   47 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~L-gLP~~K~HCA~LA~~ALk~AI~dY~~k~~   47 (64)
                      .++|+..|+.++|.++| ||||.|+||+.|+.+||+.|+.+|+.+++
T Consensus        75 ~l~ea~~i~~~~i~~~l~~l~~~r~~CA~la~~al~~a~~~y~~~~~  121 (121)
T TIGR03419        75 TLEEAWELTNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYREKNG  121 (121)
T ss_pred             CHHHHHHhhhHHHHHHHcCCCcccCHHHHHHHHHHHHHHHHHHhccC
Confidence            47899999999999999 79999999999999999999999998764


No 5  
>PF01592 NifU_N:  NifU-like N terminal domain;  InterPro: IPR002871 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] []. FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins [, ]. It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly []. The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA []. SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA [], acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins []. Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen []. This entry represents the N-terminal of NifU and homologous proteins. NifU contains two domains: an N-terminal and a C-terminal domain (IPR001075 from INTERPRO) []. These domains exist either together or on different polypeptides, both domains being found in organisms that do not fix nitrogen (e.g. yeast), so they have a broader significance in the cell than nitrogen fixation. ; GO: 0005506 iron ion binding, 0051536 iron-sulfur cluster binding, 0016226 iron-sulfur cluster assembly; PDB: 3LVL_A 4EB5_C 4EB7_C 1WFZ_A 2Z7E_C 2AZH_A 1XJS_A 1Q48_A 1R9P_A 2KQK_A ....
Probab=99.00  E-value=4.7e-10  Score=71.94  Aligned_cols=45  Identities=44%  Similarity=0.705  Sum_probs=41.6

Q ss_pred             hhHHhhcCCHHHHHHhc-CCCCchhHHHHHHHHHHHHHHHHHHHhh
Q 046034            2 ANLRNLSGLSKEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKH   46 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~L-gLP~~K~HCA~LA~~ALk~AI~dY~~k~   46 (64)
                      .++||++|+.++|.++| ++|+++.||+.|+.+||+.||.+|+.++
T Consensus        79 ~l~ea~~i~~~~i~~~l~~~~~~~~~~~~l~~~al~~av~~y~~r~  124 (126)
T PF01592_consen   79 TLEEALKITAEDIEEALGGLPPERQHCAELADDALKAAVADYPARH  124 (126)
T ss_dssp             BHHHHHCHHHHHHHHHHTC-CGTCGHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CHHHHHHHHHHHHHHHHhccccCcccHHHHHHHHHHHHHHHHHhhh
Confidence            47899999999999999 7999999999999999999999999875


No 6  
>TIGR02000 NifU_proper Fe-S cluster assembly protein NifU. Three different but partially homologous Fe-S cluster assembly systems have been described: Isc, Suf, and Nif. The latter is associated with donation of an Fe-S cluster to nitrogenase in a number of nitrogen-fixing species. NifU, described here, consists of an N-terminal domain (pfam01592) and a C-terminal domain (pfam01106). Homologs with an equivalent domain archictecture from Helicobacter and Campylobacter, however, are excluded from this model by a high trusted cutoff. The model, therefore, is specific for NifU involved in nitrogenase maturation. The related model TIGR01999 homologous to the N-terminus of this model describes IscU from the Isc system as in E. coli, Saccharomyces cerevisiae, and Homo sapiens.
Probab=98.98  E-value=5.9e-10  Score=80.87  Aligned_cols=47  Identities=32%  Similarity=0.594  Sum_probs=43.7

Q ss_pred             hhHHhhcCCHHHHHHhc-CCCCchhHHHHHHHHHHHHHHHHHHHhhCC
Q 046034            2 ANLRNLSGLSKEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKHTK   48 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~L-gLP~~K~HCA~LA~~ALk~AI~dY~~k~~~   48 (64)
                      .++||+.|++++|.++| ||||.|+||+.|+.+||+.||.+|+++...
T Consensus        80 tv~ea~~i~~~di~~~L~~lpp~r~~CA~La~~Al~~Al~~y~~kp~~  127 (290)
T TIGR02000        80 TLDEALKVSNQDIADYLGGLPPEKMHCSVMGQEALEAAIANYRGEPLE  127 (290)
T ss_pred             CHHHHHHhhHHHHHHHHcCCChhhchHHHHHHHHHHHHHHHHhcCccc
Confidence            47899999999999999 899999999999999999999999987654


No 7  
>COG0822 IscU NifU homolog involved in Fe-S cluster formation [Energy production and conversion]
Probab=98.68  E-value=1.3e-08  Score=68.22  Aligned_cols=47  Identities=43%  Similarity=0.644  Sum_probs=43.0

Q ss_pred             hhHHhhcCC--HHHHHHhcC-----------------CCCchhHHHHHHHHHHHHHHHHHHHhhCC
Q 046034            2 ANLRNLSGL--SKEIAKHLS-----------------LPPVKLHCSMLAEDAIKAAVKDYEAKHTK   48 (64)
Q Consensus         2 ~~~EA~~I~--~~dI~e~Lg-----------------LP~~K~HCA~LA~~ALk~AI~dY~~k~~~   48 (64)
                      .++||++|+  ..++.+.||                 +||.|+||++|+.+||+.||.+|..++..
T Consensus        82 ti~EAl~i~~~~~~m~~~~~~~~~~~l~d~~~l~~v~~~p~r~~C~~L~~~al~~ai~~~~~~~~~  147 (150)
T COG0822          82 TLDEALKITEAFTDMAKELGGDPDDRLGDLVALAGVALPPARIKCSLLAWDALKAAIKDYKGKAEE  147 (150)
T ss_pred             CHHHHHHHHHHHHHHHHHcCCCccchhhhhHhhhhhccccccccchhccHHHHHHHHHHhhccccc
Confidence            478999999  999999995                 89999999999999999999999988654


No 8  
>cd06664 IscU_like Iron-sulfur cluster scaffold-like proteins. IscU_like and NifU_like proteins. IscU and NifU function as a scaffold for the assembly of [2Fe-2S] clusters before they are transferred to apo target proteins. They are highly conserved and play vital roles in the ISC and NIF systems of Fe-S protein maturation. NIF genes participate in nitrogen fixation in several isolated bacterial species. The NifU domain, however, is also found in bacteria that do not fix nitrogen, so it may have wider significance in the cell. Human IscU interacts with frataxin, the Friedreich ataxia gene product, and incorrectly spliced IscU has been shown to disrupt iron homeostasis in skeletal muscle and cause myopathy.
Probab=97.77  E-value=1.9e-05  Score=49.70  Aligned_cols=37  Identities=43%  Similarity=0.589  Sum_probs=32.7

Q ss_pred             hhHHhhcCCHHHHHHh----------c-CCCCchhHHHHHHHHHHHHH
Q 046034            2 ANLRNLSGLSKEIAKH----------L-SLPPVKLHCSMLAEDAIKAA   38 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~----------L-gLP~~K~HCA~LA~~ALk~A   38 (64)
                      .++|+..|+.+.+...          + ++||.|+||+.|+.+||+.|
T Consensus        76 ~~~ea~~i~~~~~~~~~~~~~l~~~~~~~~~~~R~~Ca~L~~~Al~~a  123 (123)
T cd06664          76 TLDEALKLLNKDIAMLDGKEELAALAGVGLPPARIHCALLAWKALKAA  123 (123)
T ss_pred             cHHHHHHHHHHHHHHhcCchhHHHhcccccCcccchHHHHHHHHHHhC
Confidence            4688999999999887          5 89999999999999999864


No 9  
>TIGR01994 SUF_scaf_2 SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred.
Probab=92.79  E-value=0.15  Score=33.16  Aligned_cols=21  Identities=29%  Similarity=0.510  Sum_probs=18.6

Q ss_pred             CCCchhHHHHHHHHHHHHHHH
Q 046034           20 LPPVKLHCSMLAEDAIKAAVK   40 (64)
Q Consensus        20 LP~~K~HCA~LA~~ALk~AI~   40 (64)
                      -.|.+++|+.|+.+||+.||.
T Consensus       117 ~~p~R~~Ca~L~~~al~~al~  137 (137)
T TIGR01994       117 KFPARIKCATLAWKALERALA  137 (137)
T ss_pred             cCcchHHHHHHHHHHHHHHhC
Confidence            368999999999999999873


No 10 
>PF13075 DUF3939:  Protein of unknown function (DUF3939)
Probab=72.78  E-value=6  Score=26.90  Aligned_cols=47  Identities=21%  Similarity=0.189  Sum_probs=35.8

Q ss_pred             HhhcCCHHHHHHhc-CCCCchhHHHHH--------------HHHHHHHHHHHHHHhhCCCcc
Q 046034            5 RNLSGLSKEIAKHL-SLPPVKLHCSML--------------AEDAIKAAVKDYEAKHTKSSA   51 (64)
Q Consensus         5 EA~~I~~~dI~e~L-gLP~~K~HCA~L--------------A~~ALk~AI~dY~~k~~~~~~   51 (64)
                      +-..|+.+.+..+| |+|..++.-|--              -.+..|.||+.|..+.+.-+-
T Consensus        38 ~d~~iD~~~L~~yL~g~p~q~FymSkeTyeifeeee~~ip~~iD~VQ~AVD~Y~~e~~~lPi   99 (140)
T PF13075_consen   38 DDQSIDFERLAPYLGGIPDQRFYMSKETYEIFEEEEKDIPKEIDKVQKAVDQYVKETGKLPI   99 (140)
T ss_pred             CCceecHHHHhhhcCCCCCcceeeeHHHHHhhhHHHHhCHHHHHHHHHHHHHHHHhcCccCC
Confidence            33578899999999 898887765543              356779999999998776543


No 11 
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and (with the exception of a paralog in Thermobifida fusca YX) one-to-a-genome distribution, to represent a conserved family. This family is restricted to the Actinobacteria and each gene examined is followed by an anti-sigma factor in an apparent operon.
Probab=72.32  E-value=13  Score=24.20  Aligned_cols=39  Identities=15%  Similarity=0.153  Sum_probs=27.1

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHH-HHHHHHHHHHHHHHHh
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSM-LAEDAIKAAVKDYEAK   45 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~-LA~~ALk~AI~dY~~k   45 (64)
                      .+++.++|++.||+|+..+.--. -|.+.|+..+.++...
T Consensus       146 ~g~s~~EIA~~lgis~~tVk~~l~Rar~~Lr~~l~~~~~~  185 (193)
T TIGR02947       146 EGFAYKEIAEIMGTPIGTVMSRLHRGRKQLRKQLVDVAGE  185 (193)
T ss_pred             cCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            45788999999999877665432 2566667777666554


No 12 
>PF00325 Crp:  Bacterial regulatory proteins, crp family;  InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. This family groups together a range of proteins, including anr, crp, clp, cysR, fixK, flp, fnr, fnrN, hlyX and ntcA [, ]. Within this family, the HTH motif is situated towards the C terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2OZ6_A 1CGP_B 2GZW_C 1O3T_B 3ROU_A 2CGP_A 3RDI_A 1I5Z_A 3IYD_H 3FWE_B ....
Probab=70.48  E-value=9.8  Score=19.61  Aligned_cols=27  Identities=22%  Similarity=0.316  Sum_probs=16.9

Q ss_pred             cCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHH
Q 046034            8 SGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEA   44 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~   44 (64)
                      .++..||+++||+.+          +++-+.+.+++.
T Consensus         2 ~mtr~diA~~lG~t~----------ETVSR~l~~l~~   28 (32)
T PF00325_consen    2 PMTRQDIADYLGLTR----------ETVSRILKKLER   28 (32)
T ss_dssp             E--HHHHHHHHTS-H----------HHHHHHHHHHHH
T ss_pred             CcCHHHHHHHhCCcH----------HHHHHHHHHHHH
Confidence            578999999999874          455555655544


No 13 
>PF14131 DUF4298:  Domain of unknown function (DUF4298)
Probab=69.43  E-value=2.7  Score=25.79  Aligned_cols=27  Identities=33%  Similarity=0.373  Sum_probs=22.5

Q ss_pred             CCCCchhHHHHHHHHHHHHHHHHHHHh
Q 046034           19 SLPPVKLHCSMLAEDAIKAAVKDYEAK   45 (64)
Q Consensus        19 gLP~~K~HCA~LA~~ALk~AI~dY~~k   45 (64)
                      |.-|..+.|++|++++|-.++.++..-
T Consensus        55 g~~~~~~~~gVLSEDaiyn~lgd~~~l   81 (90)
T PF14131_consen   55 GDLPTDGKCGVLSEDAIYNALGDHYEL   81 (90)
T ss_pred             CCCCCCcccCccCchHHHHHHHHHHHH
Confidence            655678999999999999999887643


No 14 
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A. Members of this largely archaeal protein family are subunit A of the formylmethanofuran dehydrogenase. Nomenclature in some bacteria may reflect inclusion of the formyltransferase described by TIGR03119 as part of the complex, and therefore call this protein formyltransferase/hydrolase complex Fhc subunit A. Note that this model does not distinguish tungsten (FwdA) from molybdenum-containing (FmdA) forms of this enzyme; a single gene from this family is expressed constitutively in Methanobacterium thermoautotrophicum, which has both tungsten and molybdenum forms and may work interchangeably.
Probab=67.70  E-value=1.6  Score=34.88  Aligned_cols=26  Identities=35%  Similarity=0.629  Sum_probs=20.3

Q ss_pred             hcCCHHHHHHhc-------CCC-CchhHHHHHHH
Q 046034            7 LSGLSKEIAKHL-------SLP-PVKLHCSMLAE   32 (64)
Q Consensus         7 ~~I~~~dI~e~L-------gLP-~~K~HCA~LA~   32 (64)
                      +.||+.+|+..|       ||| +.++||.+|+.
T Consensus       207 ~~vtp~~i~~~l~~~~e~l~lph~~h~H~nnlg~  240 (556)
T TIGR03121       207 FGITPREIIKGLARANEELGLPHSIHVHCNNLGV  240 (556)
T ss_pred             CCCCHHHHHHHHHHHHHhcCCCceEEEecCCCCC
Confidence            467888877655       798 78999999974


No 15 
>PF08383 Maf_N:  Maf N-terminal region;  InterPro: IPR013592 This region is found in various leucine zipper transcription factors of the Maf family. These are implicated in the regulation of insulin gene expression [], in erythroid differentiation [], and in differentiation of the neuroretina []. 
Probab=65.71  E-value=4.8  Score=21.59  Aligned_cols=16  Identities=19%  Similarity=0.175  Sum_probs=14.1

Q ss_pred             hHHhhcCCHHHHHHhc
Q 046034            3 NLRNLSGLSKEIAKHL   18 (64)
Q Consensus         3 ~~EA~~I~~~dI~e~L   18 (64)
                      +.|++.+|.+|.+|+|
T Consensus        17 ~pe~l~LtpEDAvEaL   32 (35)
T PF08383_consen   17 NPEALGLTPEDAVEAL   32 (35)
T ss_pred             ChhhcCCCHHHHHHHH
Confidence            4689999999999988


No 16 
>PRK12519 RNA polymerase sigma factor; Provisional
Probab=64.32  E-value=18  Score=23.36  Aligned_cols=37  Identities=19%  Similarity=0.156  Sum_probs=25.4

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHH-HHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSML-AEDAIKAAVKDYE   43 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~L-A~~ALk~AI~dY~   43 (64)
                      .+++.++|++.||+++.-+.--.- |.+-|+..+.+|.
T Consensus       156 ~g~s~~EIA~~lgis~~tV~~~l~Ra~~~Lr~~l~~~~  193 (194)
T PRK12519        156 EGLSQSEIAKRLGIPLGTVKARARQGLLKLRELLQDLL  193 (194)
T ss_pred             cCCCHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHh
Confidence            357889999999998877665433 5556666665553


No 17 
>PF12918 TcdB_N:  TcdB toxin N-terminal helical domain;  InterPro: IPR024772 Toxins A (TcdA) and B (TcdB) of Clostridium difficile belong to the family of clostridial glucosylating toxins. These toxins glucosylate small GTPases of Rho and Ras families, inhibiting the signalling and regulatory functions of these switch proteins. After receptor-binding, the toxins are endocytosed to reach acidic endosomal compartments from where the toxins are translocated into the cytosol [].   TcdB has been shown to consist of a N-terminal glucosyltransferase domain (GTD), responsible for the biological effects of the toxin, a cysteine protease domain (CPD), responsible for autocatalytic cleavage, a hydrophobic region (HR), which has been suggested to be involved in toxin translocation, and a C-terminal repetitive domain involved in receptor binding. The pore-forming region of toxin B has been described to be in a region in the middle of the protein, within amino acid residues 830 and 990 []. This entry represents a short helical bundle domain found associated with the catalytic domain of TcdA and TcdB []. It is also found in some other toxins. The function of this domain is unknown, but it may be involved in substrate recognition.; PDB: 2VKH_C 2VL8_A 2VKD_A 2BVL_A 2BVM_A 3SS1_A 3SRZ_A 2VK9_A.
Probab=62.36  E-value=21  Score=20.92  Aligned_cols=41  Identities=15%  Similarity=0.110  Sum_probs=30.3

Q ss_pred             cCCHHHHHHhc-CCCCchhHHHHHHHHHHHHHHHHHHHhhCC
Q 046034            8 SGLSKEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKHTK   48 (64)
Q Consensus         8 ~I~~~dI~e~L-gLP~~K~HCA~LA~~ALk~AI~dY~~k~~~   48 (64)
                      +++.+.|.+.| +|.+...-=-..-.+=|+.+|..|+.....
T Consensus         4 dl~~~ni~~~l~~l~~~~~~~~~~~l~~lk~~I~~Y~~l~~~   45 (66)
T PF12918_consen    4 DLTIDNIEEKLFKLTEEQSPKCYELLKKLKKAIDNYNNLYEN   45 (66)
T ss_dssp             HHHHHHHHHHHHTTTTS-HHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HhHHHHHHHHhhccCccccHHHHHHHHHHHHHHHHHHHHhhh
Confidence            45677888998 887665555556678899999999998433


No 18 
>PF04539 Sigma70_r3:  Sigma-70 region 3;  InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 3 forms a discrete compact three helical domain within the sigma-factor. Region is not normally involved in the recognition of promoter DNA, but in some specific bacterial promoters containing an extended -10 promoter element, residues within region 3 play an important role. Region 3 primarily is involved in binding the core RNA polymerase in the holoenzyme [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1L0O_C 1KU2_B 1RP3_C 1SC5_A 1TTY_A 2BE5_F 2A6E_F 2CW0_F 2A69_P 2A6H_P ....
Probab=61.09  E-value=4.5  Score=22.91  Aligned_cols=18  Identities=22%  Similarity=0.333  Sum_probs=14.4

Q ss_pred             CCHHHHHHhcCCCCchhH
Q 046034            9 GLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         9 I~~~dI~e~LgLP~~K~H   26 (64)
                      -|.++|++.||++.++++
T Consensus        21 Pt~eEiA~~lgis~~~v~   38 (78)
T PF04539_consen   21 PTDEEIAEELGISVEEVR   38 (78)
T ss_dssp             -BHHHHHHHHTS-HHHHH
T ss_pred             CCHHHHHHHHcccHHHHH
Confidence            478899999999998876


No 19 
>PRK12512 RNA polymerase sigma factor; Provisional
Probab=59.60  E-value=22  Score=22.70  Aligned_cols=37  Identities=22%  Similarity=0.183  Sum_probs=26.9

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhhCCC
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKHTKS   49 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k~~~~   49 (64)
                      .+++.++|++.||+|...++      ..++.|....+.+-.++
T Consensus       146 ~g~s~~eIA~~l~is~~tV~------~~l~ra~~~Lr~~l~~~  182 (184)
T PRK12512        146 EGASIKETAAKLSMSEGAVR------VALHRGLAALAAKFRSE  182 (184)
T ss_pred             cCCCHHHHHHHhCCCHHHHH------HHHHHHHHHHHHHhhcC
Confidence            46788999999999976553      66777777777665443


No 20 
>PF10470 AKAP7_RIRII_bdg:  PKA-RI-RII subunit binding domain of A-kinase anchor protein;  InterPro: IPR019511 This entry represents the RI-RII subunit-binding domain found at the C-terminal of the cyclic AMP-dependent protein kinase A (PKA) anchor protein, AKAP7. This protein anchors PKA, for its role in regulating PKA-mediated gene transcription in both somatic cells and oocytes, by binding to its regulatory subunits, RI and RII, hence being known as a dual-specific AKAP []. The 25 crucial amino acids of RII-binding domains in general form structurally conserved amphipathic helices with unrelated sequences; hydrophobic amino acid residues form the backbone of the interaction and hydrogen bond- and salt-bridge-forming amino acid residues increase the affinity of the interaction []. The nuclear localisation signal-containing domain is found at the N terminus. 
Probab=57.71  E-value=16  Score=21.71  Aligned_cols=27  Identities=22%  Similarity=0.373  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHHhhCCCcccccc
Q 046034           29 MLAEDAIKAAVKDYEAKHTKSSAASEA   55 (64)
Q Consensus        29 ~LA~~ALk~AI~dY~~k~~~~~~~~~~   55 (64)
                      .|...|+-+|+..|.....++...+.+
T Consensus        15 rlVenAVlkAvQQy~eEtq~k~~~~~g   41 (61)
T PF10470_consen   15 RLVENAVLKAVQQYLEETQNKEQPGDG   41 (61)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhccCCCC
Confidence            467899999999999887655555544


No 21 
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=57.37  E-value=6.8  Score=22.90  Aligned_cols=17  Identities=24%  Similarity=0.212  Sum_probs=14.6

Q ss_pred             cCCHHHHHHhcCCCCch
Q 046034            8 SGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K   24 (64)
                      .|+..||++.||.++..
T Consensus        22 ~i~lkdIA~~Lgvs~~t   38 (60)
T PF10668_consen   22 KIKLKDIAEKLGVSEST   38 (60)
T ss_pred             CccHHHHHHHHCCCHHH
Confidence            58999999999998654


No 22 
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional
Probab=54.25  E-value=27  Score=22.48  Aligned_cols=38  Identities=18%  Similarity=0.130  Sum_probs=25.8

Q ss_pred             hcCCHHHHHHhcCCCCchhHH-HHHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHC-SMLAEDAIKAAVKDYEA   44 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HC-A~LA~~ALk~AI~dY~~   44 (64)
                      .+.+.++|++.||+++..+.= -.-+...|+..|..|..
T Consensus       153 ~g~s~~eIA~~lgis~~tv~~~l~Rar~~Lr~~l~~~~~  191 (193)
T PRK11923        153 DGLSYEDIASVMQCPVGTVRSRIFRAREAIDKALQPLLQ  191 (193)
T ss_pred             cCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            457788999999998665542 23366677777776654


No 23 
>PF06926 Rep_Org_C:  Putative replisome organiser protein C-terminus;  InterPro: IPR009696 This entry represents the C terminus (approximately 100 residues) of a putative replisome organiser protein in Lactococcus bacteriophages [].
Probab=51.69  E-value=31  Score=22.10  Aligned_cols=37  Identities=11%  Similarity=0.303  Sum_probs=28.2

Q ss_pred             HHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhhCCCccc
Q 046034           13 EIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKHTKSSAA   52 (64)
Q Consensus        13 dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k~~~~~~~   52 (64)
                      ...+++.||+....|++.+..=-   |..|..+...++.+
T Consensus        25 A~~eFi~L~~~QkeqaViGA~NY---~~~Ykn~~~dD~~~   61 (95)
T PF06926_consen   25 ALQEFIKLPSEQKEQAVIGAKNY---VQWYKNENPDDNTG   61 (95)
T ss_pred             HHHHHHHcCHHHHHHHHHhHHHH---HHHHHHcCCCCCCc
Confidence            44566689999999999887654   88888887766544


No 24 
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=48.35  E-value=13  Score=20.98  Aligned_cols=31  Identities=29%  Similarity=0.348  Sum_probs=24.7

Q ss_pred             HHhcCCCCchhHHHHHHHHHHHHHHHHHHHh
Q 046034           15 AKHLSLPPVKLHCSMLAEDAIKAAVKDYEAK   45 (64)
Q Consensus        15 ~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k   45 (64)
                      ++.||.+++.+.=++=.+..-..+|..|++|
T Consensus        27 a~~~gvt~~~L~~AV~~vG~~~~~V~~~L~k   57 (57)
T PF12244_consen   27 AKRFGVTEEQLREAVRAVGNSRAAVRAYLGK   57 (57)
T ss_pred             HHHHCcCHHHHHHHHHHHCcCHHHHHHHHcC
Confidence            3445899999888888888888888888765


No 25 
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A;  Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor. FMDH catalyzes the first step in methanogenesis, the formyl-methanofuran synthesis. In this step, CO2 is bound to methanofuran and subsequently reduced to the formyl state with electrons derived from hydrogen.
Probab=48.16  E-value=5.8  Score=31.77  Aligned_cols=26  Identities=35%  Similarity=0.625  Sum_probs=20.3

Q ss_pred             hcCCHHHHHHhc-------CCC-CchhHHHHHHH
Q 046034            7 LSGLSKEIAKHL-------SLP-PVKLHCSMLAE   32 (64)
Q Consensus         7 ~~I~~~dI~e~L-------gLP-~~K~HCA~LA~   32 (64)
                      +.||+.+|+..|       ||| +.++||.+|+.
T Consensus       203 ~~vtp~~ii~~l~~~~~~lg~ph~iH~h~nnlg~  236 (541)
T cd01304         203 FDITPREILKGLAEANEELGLPHSIHVHCNNLGV  236 (541)
T ss_pred             CCCCHHHHHHHHHHHHHhcCCceEEEEccccCCC
Confidence            467888777655       788 89999999964


No 26 
>PF13735 tRNA_NucTran2_2:  tRNA nucleotidyltransferase domain 2 putative; PDB: 1MIY_A 1MIV_B 1MIW_B.
Probab=45.30  E-value=15  Score=23.09  Aligned_cols=19  Identities=16%  Similarity=0.239  Sum_probs=12.7

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      +.||..||.+.||++|-+.
T Consensus       103 LaI~G~DLi~~lg~~pGp~  121 (149)
T PF13735_consen  103 LAINGNDLIEALGIKPGPW  121 (149)
T ss_dssp             -SS-HHHHHHHHT--SSCH
T ss_pred             CCcCHHHHHHHcCCCCCcH
Confidence            4699999999999976554


No 27 
>PF04545 Sigma70_r4:  Sigma-70, region 4;  InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors is involved in binding to the -35 promoter element via a helix-turn-helix motif []. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2P7V_B 3IYD_F 1TLH_B 1KU7_A 1RIO_H 3N97_A 1KU3_A 1RP3_C 1SC5_A 1NR3_A ....
Probab=43.97  E-value=48  Score=17.23  Aligned_cols=19  Identities=21%  Similarity=0.244  Sum_probs=14.6

Q ss_pred             cCCHHHHHHhcCCCCchhH
Q 046034            8 SGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~H   26 (64)
                      +.|..+|++.||++...++
T Consensus        20 ~~t~~eIa~~lg~s~~~V~   38 (50)
T PF04545_consen   20 GLTLEEIAERLGISRSTVR   38 (50)
T ss_dssp             T-SHHHHHHHHTSCHHHHH
T ss_pred             CCCHHHHHHHHCCcHHHHH
Confidence            5788999999999866654


No 28 
>PF14791 DNA_pol_B_thumb:  DNA polymerase beta thumb ; PDB: 1HUZ_A 3K75_D 1HUO_A 2BPC_A 1RPL_A 1NOM_A 1ZQX_A 1ZQU_A 1ZQZ_A 1ZQV_A ....
Probab=42.84  E-value=15  Score=21.20  Aligned_cols=19  Identities=26%  Similarity=0.303  Sum_probs=13.5

Q ss_pred             CCHHHHHHhcCC---CCchhHH
Q 046034            9 GLSKEIAKHLSL---PPVKLHC   27 (64)
Q Consensus         9 I~~~dI~e~LgL---P~~K~HC   27 (64)
                      -+.+||.+.|||   ||+...|
T Consensus        43 ~~E~dif~~Lgl~yipPe~R~~   64 (64)
T PF14791_consen   43 ESEEDIFDALGLPYIPPELRED   64 (64)
T ss_dssp             SSHHHHHHHTTS----GGGCTT
T ss_pred             CCHHHHHHHcCCCCCChhhcCC
Confidence            378899999985   5665554


No 29 
>PRK12532 RNA polymerase sigma factor; Provisional
Probab=42.36  E-value=68  Score=20.73  Aligned_cols=37  Identities=16%  Similarity=0.142  Sum_probs=23.0

Q ss_pred             hcCCHHHHHHhcCCCCchhHH-HHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHC-SMLAEDAIKAAVKDYE   43 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HC-A~LA~~ALk~AI~dY~   43 (64)
                      .+++.++|++.||+|+.-+.= -.-|.+.|+..+..+.
T Consensus       151 ~g~s~~EIA~~lgis~~tVk~~l~Rar~~Lr~~l~~~~  188 (195)
T PRK12532        151 LGFSSDEIQQMCGISTSNYHTIMHRARESLRQCLQIKW  188 (195)
T ss_pred             hCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHhh
Confidence            467889999999988655431 1234555555555443


No 30 
>PF06056 Terminase_5:  Putative ATPase subunit of terminase (gpP-like);  InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after []. Terminases are viral proteins that are involved in packaging viral DNA into the capsid.; GO: 0005524 ATP binding, 0019069 viral capsid assembly
Probab=41.78  E-value=22  Score=20.16  Aligned_cols=15  Identities=40%  Similarity=0.450  Sum_probs=12.6

Q ss_pred             cCCHHHHHHhcCCCC
Q 046034            8 SGLSKEIAKHLSLPP   22 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~   22 (64)
                      ..+..+|++.||+|+
T Consensus        13 G~~~~eIA~~Lg~~~   27 (58)
T PF06056_consen   13 GWSIKEIAEELGVPR   27 (58)
T ss_pred             CCCHHHHHHHHCCCh
Confidence            467889999999983


No 31 
>PRK02919 oxaloacetate decarboxylase subunit gamma; Provisional
Probab=39.73  E-value=25  Score=21.54  Aligned_cols=14  Identities=21%  Similarity=0.237  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHhhC
Q 046034           34 AIKAAVKDYEAKHT   47 (64)
Q Consensus        34 ALk~AI~dY~~k~~   47 (64)
                      ++.+||..||.+++
T Consensus        69 vIsAAI~~hR~~~~   82 (82)
T PRK02919         69 VIAAAIHHHRRLNA   82 (82)
T ss_pred             HHHHHHHHHHhcCC
Confidence            89999999998753


No 32 
>TIGR01764 excise DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376).
Probab=39.56  E-value=22  Score=17.62  Aligned_cols=15  Identities=20%  Similarity=0.042  Sum_probs=9.0

Q ss_pred             CCHHHHHHhcCCCCc
Q 046034            9 GLSKEIAKHLSLPPV   23 (64)
Q Consensus         9 I~~~dI~e~LgLP~~   23 (64)
                      +|-+++++.||+++.
T Consensus         2 lt~~e~a~~lgis~~   16 (49)
T TIGR01764         2 LTVEEAAEYLGVSKD   16 (49)
T ss_pred             CCHHHHHHHHCCCHH
Confidence            355666666666643


No 33 
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=39.49  E-value=84  Score=18.74  Aligned_cols=43  Identities=19%  Similarity=0.233  Sum_probs=32.6

Q ss_pred             HhhcCCHHHHHHhcCCCCchhHHHHHH-----HHHHHHHHHHHHHhhC
Q 046034            5 RNLSGLSKEIAKHLSLPPVKLHCSMLA-----EDAIKAAVKDYEAKHT   47 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K~HCA~LA-----~~ALk~AI~dY~~k~~   47 (64)
                      +-+.-+.+.++..||+++..+.+...=     .+-....+..|+.+.+
T Consensus        12 ~~LG~dWk~LAr~Lg~se~dI~~i~~~~~~~~~eq~~~mL~~W~~r~g   59 (84)
T cd08804          12 DHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDG   59 (84)
T ss_pred             HHHhhhHHHHHHHcCCCHHHHHHHHHHCcccHHHHHHHHHHHHHHccC
Confidence            445677889999999999999884443     5666777888887765


No 34 
>PRK12520 RNA polymerase sigma factor; Provisional
Probab=39.27  E-value=40  Score=21.74  Aligned_cols=20  Identities=20%  Similarity=0.267  Sum_probs=14.0

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+|+.-+.
T Consensus       146 ~g~s~~EIA~~lgis~~tV~  165 (191)
T PRK12520        146 LELETEEICQELQITATNAW  165 (191)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            35677888888888765544


No 35 
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=38.56  E-value=22  Score=18.56  Aligned_cols=12  Identities=33%  Similarity=0.363  Sum_probs=6.0

Q ss_pred             CHHHHHHhcCCC
Q 046034           10 LSKEIAKHLSLP   21 (64)
Q Consensus        10 ~~~dI~e~LgLP   21 (64)
                      |.+++++.||++
T Consensus         3 t~~e~a~~l~is   14 (51)
T PF12728_consen    3 TVKEAAELLGIS   14 (51)
T ss_pred             CHHHHHHHHCcC
Confidence            444555555544


No 36 
>PRK12513 RNA polymerase sigma factor; Provisional
Probab=38.27  E-value=70  Score=20.61  Aligned_cols=20  Identities=20%  Similarity=0.101  Sum_probs=16.4

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+|+..++
T Consensus       154 ~g~s~~EIA~~lgis~~tV~  173 (194)
T PRK12513        154 GDLELEEIAELTGVPEETVK  173 (194)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            35788999999999987664


No 37 
>PF10078 DUF2316:  Uncharacterized protein conserved in bacteria (DUF2316);  InterPro: IPR018757  Members of this family of hypothetical bacterial proteins have no known function. 
Probab=37.42  E-value=30  Score=21.62  Aligned_cols=25  Identities=28%  Similarity=0.252  Sum_probs=20.5

Q ss_pred             hhHHhhcCCHHHHHHhcCCCCchhH
Q 046034            2 ANLRNLSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~LgLP~~K~H   26 (64)
                      +|-+-..++.++|+..||+.+++++
T Consensus        17 ~nf~~~~ls~~~ia~dL~~s~~~le   41 (89)
T PF10078_consen   17 ANFELSGLSLEQIAADLGTSPEHLE   41 (89)
T ss_pred             HHHHHcCCCHHHHHHHhCCCHHHHH
Confidence            3556678899999999999888876


No 38 
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated
Probab=37.05  E-value=73  Score=19.74  Aligned_cols=32  Identities=22%  Similarity=0.360  Sum_probs=22.7

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEA   44 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~   44 (64)
                      .+.+.++|++.||+|...++.      -|+.|+...+.
T Consensus       124 ~~~s~~EIA~~lgis~~tV~~------~l~ra~~~lr~  155 (163)
T PRK07037        124 HGETQKDIARELGVSPTLVNF------MIRDALVHCRK  155 (163)
T ss_pred             cCCCHHHHHHHHCCCHHHHHH------HHHHHHHHHHH
Confidence            467899999999999877663      34555555443


No 39 
>PRK05803 sporulation sigma factor SigK; Reviewed
Probab=36.35  E-value=70  Score=21.64  Aligned_cols=33  Identities=18%  Similarity=0.095  Sum_probs=22.3

Q ss_pred             cCCHHHHHHhcCCCCchhHHH-HHHHHHHHHHHH
Q 046034            8 SGLSKEIAKHLSLPPVKLHCS-MLAEDAIKAAVK   40 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~HCA-~LA~~ALk~AI~   40 (64)
                      ..+.++|++.||+++..+..- .-|.+.|+.-+.
T Consensus       195 ~~S~~EIA~~lgis~~tV~~~~~rA~~kLr~~l~  228 (233)
T PRK05803        195 EKTQREIAKALGISRSYVSRIEKRALKKLFKELY  228 (233)
T ss_pred             CcCHHHHHHHHCcCHHHHHHHHHHHHHHHHHHHH
Confidence            358899999999998877544 345555554443


No 40 
>PRK12522 RNA polymerase sigma factor; Provisional
Probab=36.01  E-value=95  Score=19.59  Aligned_cols=20  Identities=20%  Similarity=0.180  Sum_probs=14.7

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+++.-+.
T Consensus       134 ~~~s~~EIA~~lgis~~tV~  153 (173)
T PRK12522        134 EQYSYKEMSEILNIPIGTVK  153 (173)
T ss_pred             cCCCHHHHHHHhCCCHHHHH
Confidence            45778889988888865543


No 41 
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family. Several PFAM models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.
Probab=35.58  E-value=83  Score=18.22  Aligned_cols=20  Identities=25%  Similarity=0.109  Sum_probs=14.9

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+..+|++.||+++..++
T Consensus       125 ~g~s~~eIA~~l~~s~~~v~  144 (158)
T TIGR02937       125 EGLSYKEIAEILGISVGTVK  144 (158)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            35788888888888866554


No 42 
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or plastid core RNA polymerase to specific promoter elements located upstream of transcription initiation points. The SR4 of Ec sigma70 and other essential primary SFs contact promoter sequences located 35 base-pairs upstream of the initiation point, recognizing a 6-base-pair -35 consensus TTGACA.  Sigma70 related SFs also include SFs which are dispensable for bacterial cell growth for example Ec sigmaS, SFs which activate regulons in response to a specific signal for example heat-shock Ec sigmaH, and a group of SFs which includes the extracytoplasmic function (ECF) SFs and is typified by Ec sigmaE which contains SR2 and -4 only. ECF SFs direct the transcription of genes that regulate various responses including periplas
Probab=35.51  E-value=29  Score=16.85  Aligned_cols=18  Identities=22%  Similarity=0.099  Sum_probs=12.8

Q ss_pred             hcCCHHHHHHhcCCCCch
Q 046034            7 LSGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K   24 (64)
                      .+++..+|++.+|++...
T Consensus        25 ~~~~~~~ia~~~~~s~~~   42 (55)
T cd06171          25 EGLSYEEIAEILGISRST   42 (55)
T ss_pred             cCCCHHHHHHHHCcCHHH
Confidence            357788888888877443


No 43 
>PRK05602 RNA polymerase sigma factor; Reviewed
Probab=35.38  E-value=79  Score=20.20  Aligned_cols=20  Identities=15%  Similarity=-0.002  Sum_probs=15.9

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      ...+.++|++.||+|+..+.
T Consensus       143 ~g~s~~EIA~~lgis~~tV~  162 (186)
T PRK05602        143 QGLSNIEAAAVMDISVDALE  162 (186)
T ss_pred             cCCCHHHHHHHhCcCHHHHH
Confidence            46788999999999876654


No 44 
>PRK09652 RNA polymerase sigma factor RpoE; Provisional
Probab=34.64  E-value=91  Score=19.25  Aligned_cols=20  Identities=20%  Similarity=0.091  Sum_probs=16.0

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+++.++|++.||+|+..+.
T Consensus       143 ~~~s~~eIA~~lgis~~tV~  162 (182)
T PRK09652        143 EGLSYEEIAEIMGCPIGTVR  162 (182)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            46788999999999877664


No 45 
>KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription]
Probab=34.24  E-value=40  Score=23.68  Aligned_cols=34  Identities=15%  Similarity=0.259  Sum_probs=23.5

Q ss_pred             cCCHHHHHHhc-CCCCchhHHHHHHHHHHHHHHHHHHHhhC
Q 046034            8 SGLSKEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKHT   47 (64)
Q Consensus         8 ~I~~~dI~e~L-gLP~~K~HCA~LA~~ALk~AI~dY~~k~~   47 (64)
                      .|+.+||+..| .|.-..+|      .-|+.++..|+....
T Consensus        65 t~sadDVl~aL~Eiefs~f~------~plk~~Le~yk~~~k   99 (172)
T KOG0870|consen   65 TISADDVLKALDEIEFSSFV------NPLKSALEAYKKAVK   99 (172)
T ss_pred             cccHHHHHHHHHHhchHHHh------hHHHHHHHHHHHHHH
Confidence            58999999999 44333333      457888888876543


No 46 
>PRK11924 RNA polymerase sigma factor; Provisional
Probab=34.20  E-value=69  Score=19.74  Aligned_cols=19  Identities=26%  Similarity=0.204  Sum_probs=15.0

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      ..++.++|++.||+++.-+
T Consensus       140 ~~~~~~eIA~~lgis~~tv  158 (179)
T PRK11924        140 EGLSYREIAEILGVPVGTV  158 (179)
T ss_pred             cCCCHHHHHHHHCCCHHHH
Confidence            4678899999999986544


No 47 
>PRK06811 RNA polymerase factor sigma-70; Validated
Probab=34.10  E-value=96  Score=20.04  Aligned_cols=34  Identities=24%  Similarity=0.324  Sum_probs=22.4

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhh
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKH   46 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k~   46 (64)
                      .+++.++|++.||++...++      .-|++|...-+...
T Consensus       146 ~g~s~~EIAe~lgis~~~V~------~~l~Ra~~~Lr~~~  179 (189)
T PRK06811        146 LGEKIEEIAKKLGLTRSAID------NRLSRGRKKLQKNK  179 (189)
T ss_pred             ccCCHHHHHHHHCCCHHHHH------HHHHHHHHHHHHcc
Confidence            35788999999999876654      44555555544433


No 48 
>PRK10030 hypothetical protein; Provisional
Probab=33.92  E-value=25  Score=24.18  Aligned_cols=20  Identities=20%  Similarity=0.272  Sum_probs=17.5

Q ss_pred             CCCchhHHHHHHHHHHHHHH
Q 046034           20 LPPVKLHCSMLAEDAIKAAV   39 (64)
Q Consensus        20 LP~~K~HCA~LA~~ALk~AI   39 (64)
                      +..++++||.|..++.+.|.
T Consensus       121 ~~d~~~YCSELV~~ay~~a~  140 (197)
T PRK10030        121 WSDDRIYCSELVWKVYQNAL  140 (197)
T ss_pred             cCCCcEEeHHHHHHHHHHcc
Confidence            56789999999999998873


No 49 
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family. This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937) and is restricted to certain lineages of the order Bacillales. This family encompasses at least two distinct sigma factors as two proteins are found in each of B. anthracis, B. subtilis subsp. subtilis str. 168, and B. lichiniformis (although these are not apparently the same two in each). One of these is designated as SigM in B. subtilis (Swiss_Prot:  SIGM_BACSU) and is activated by various stressors.
Probab=33.14  E-value=1e+02  Score=18.73  Aligned_cols=20  Identities=35%  Similarity=0.237  Sum_probs=15.1

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+|+..+.
T Consensus       120 ~g~s~~eIA~~lgis~~tv~  139 (154)
T TIGR02950       120 KEFSYKEIAELLNLSLAKVK  139 (154)
T ss_pred             ccCcHHHHHHHHCCCHHHHH
Confidence            46788899999999855543


No 50 
>PRK12536 RNA polymerase sigma factor; Provisional
Probab=33.07  E-value=98  Score=19.79  Aligned_cols=19  Identities=16%  Similarity=-0.031  Sum_probs=14.7

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      -+.+.++|++.||+|+..+
T Consensus       144 ~g~s~~EIA~~l~is~~tV  162 (181)
T PRK12536        144 EGLSVAETAQLTGLSESAV  162 (181)
T ss_pred             cCCCHHHHHHHHCCCHHHH
Confidence            4578889999998886554


No 51 
>PF11387 DUF2795:  Protein of unknown function (DUF2795);  InterPro: IPR021527  This family of proteins has no known function. 
Probab=32.65  E-value=20  Score=19.31  Aligned_cols=16  Identities=19%  Similarity=0.407  Sum_probs=11.9

Q ss_pred             HHHHHHhc-CCCCchhH
Q 046034           11 SKEIAKHL-SLPPVKLH   26 (64)
Q Consensus        11 ~~dI~e~L-gLP~~K~H   26 (64)
                      .++|++.| +||+..++
T Consensus        23 ~~~vl~~L~~lP~~~Y~   39 (44)
T PF11387_consen   23 PDDVLDALERLPDREYE   39 (44)
T ss_pred             CHHHHHHHHHCCccCCC
Confidence            35788999 89976654


No 52 
>PF00531 Death:  Death domain;  InterPro: IPR000488 The death domain (DD) is a homotypic protein interaction module composed of a bundle of six alpha-helices. DD is related in sequence and structure to the death effector domain (DED, see IPR001875 from INTERPRO) and the caspase recruitment domain (CARD, see IPR001315 from INTERPRO), which work in similar pathways and show similar interaction properties []. DD bind each other forming oligomers. Mammals have numerous and diverse DD-containing proteins []. Within these proteins, the DD domains can be found in combination with other domains, including: CARDs, DEDs, ankyrin repeats (IPR002110 from INTERPRO), caspase-like folds, kinase domains, leucine zippers (IPR002158 from INTERPRO), leucine-rich repeats (LRR) (IPR001611 from INTERPRO), TIR domains (IPR000157 from INTERPRO), and ZU5 domains (IPR000906 from INTERPRO) []. Some DD-containing proteins are involved in the regulation of apoptosis and inflammation through their activation of caspases and NF-kappaB, which typically involves interactions with TNF (tumour necrosis factor) cytokine receptors [, ]. In humans, eight of the over 30 known TNF receptors contain DD in their cytoplasmic tails; several of these TNF receptors use caspase activation as a signalling mechanism. The DD mediates self-association of these receptors, thus giving the signal to downstream events that lead to apoptosis. Other DD-containing proteins, such as ankyrin, MyD88 and pelle, are probably not directly involved in cell death signalling. DD-containing proteins also have links to innate immunity, communicating with Toll family receptors through bipartite adapter proteins such as MyD88 [].; GO: 0005515 protein binding, 0007165 signal transduction; PDB: 3OQ9_L 3EZQ_F 1E41_A 1E3Y_A 2GF5_A 2OF5_L 3EWV_E 3G5B_A 3MOP_L 2A9I_A ....
Probab=32.45  E-value=93  Score=17.18  Aligned_cols=39  Identities=13%  Similarity=0.198  Sum_probs=28.0

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHH----HHHHHHHHHHHHh
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAE----DAIKAAVKDYEAK   45 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~----~ALk~AI~dY~~k   45 (64)
                      ..-+.+.++..||++...+.....--    +-....+..|+.+
T Consensus        11 ~~~~Wk~La~~Lg~~~~~i~~i~~~~~~~~~~~~~~L~~W~~~   53 (83)
T PF00531_consen   11 LGSDWKRLARKLGLSESEIENIEEENPDLREQTYEMLQRWRQR   53 (83)
T ss_dssp             HSTCHHHHHHHTTS-HHHHHHHHHHSTSHHHHHHHHHHHHHHH
T ss_pred             chhhHHHHHHHhCcCHHHHHHHHHhCCChHHHHHHHHHHHHHh
Confidence            34567889999999888877666544    5666777888877


No 53 
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=32.36  E-value=1.1e+02  Score=18.12  Aligned_cols=42  Identities=14%  Similarity=0.155  Sum_probs=28.9

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHH----HHHHHHHHHHHHHhhCC
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLA----EDAIKAAVKDYEAKHTK   48 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA----~~ALk~AI~dY~~k~~~   48 (64)
                      +.-+.++++..|||++..+.....-    .+....-+..|+.+.+.
T Consensus        17 iG~~Wk~Lar~LGls~~dI~~i~~~~~~~~eq~~~mL~~W~~r~g~   62 (86)
T cd08318          17 LGEDWKTLAPHLEMKDKEIRAIESDSEDIKMQAKQLLVAWQDREGS   62 (86)
T ss_pred             HhhhHHHHHHHcCCCHHHHHHHHhcCCCHHHHHHHHHHHHHHhcCc
Confidence            4456788888889988877665532    35556667778777653


No 54 
>PRK12530 RNA polymerase sigma factor; Provisional
Probab=32.30  E-value=1.1e+02  Score=19.83  Aligned_cols=20  Identities=25%  Similarity=0.356  Sum_probs=15.2

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+|+.-+.
T Consensus       149 ~g~s~~EIA~~lgis~~tVk  168 (189)
T PRK12530        149 LELSSEQICQECDISTSNLH  168 (189)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            46788888888888876554


No 55 
>PRK08583 RNA polymerase sigma factor SigB; Validated
Probab=31.96  E-value=79  Score=21.66  Aligned_cols=20  Identities=15%  Similarity=0.194  Sum_probs=15.5

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+++.++|++.||+|+..++
T Consensus       220 ~g~s~~eIA~~l~is~~tV~  239 (257)
T PRK08583        220 ENLSQKETGERLGISQMHVS  239 (257)
T ss_pred             CCCCHHHHHHHHCCCHHHHH
Confidence            35678888888888877765


No 56 
>PRK09645 RNA polymerase sigma factor SigL; Provisional
Probab=31.85  E-value=95  Score=19.47  Aligned_cols=20  Identities=20%  Similarity=0.248  Sum_probs=15.0

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+|+.-++
T Consensus       133 ~g~s~~EIA~~lgis~~tV~  152 (173)
T PRK09645        133 RGWSTAQIAADLGIPEGTVK  152 (173)
T ss_pred             cCCCHHHHHHHHCcCHHHHH
Confidence            36788889998888865543


No 57 
>PRK12535 RNA polymerase sigma factor; Provisional
Probab=31.17  E-value=78  Score=20.92  Aligned_cols=38  Identities=21%  Similarity=0.069  Sum_probs=23.0

Q ss_pred             hcCCHHHHHHhcCCCCchhHHH-HHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCS-MLAEDAIKAAVKDYEA   44 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA-~LA~~ALk~AI~dY~~   44 (64)
                      .+++.++|++.||+|+.-++=- .-|...|+..+.+|..
T Consensus       148 ~g~s~~EIAe~lgis~~tV~~~l~Rar~~Lr~~l~~~~~  186 (196)
T PRK12535        148 LGYTYEEAAKIADVRVGTIRSRVARARADLIAATATGQA  186 (196)
T ss_pred             hCCCHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhccccc
Confidence            4678889999998887554422 2244455555555443


No 58 
>PHA01623 hypothetical protein
Probab=31.02  E-value=57  Score=18.37  Aligned_cols=15  Identities=40%  Similarity=0.632  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHhh
Q 046034           32 EDAIKAAVKDYEAKH   46 (64)
Q Consensus        32 ~~ALk~AI~dY~~k~   46 (64)
                      -++++.||..|..+.
T Consensus        40 Se~IreAI~~yL~~~   54 (56)
T PHA01623         40 TQAIEEAIKEYLQKR   54 (56)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            478899999998764


No 59 
>PRK09647 RNA polymerase sigma factor SigE; Reviewed
Probab=30.91  E-value=81  Score=21.07  Aligned_cols=32  Identities=19%  Similarity=0.104  Sum_probs=21.0

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEA   44 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~   44 (64)
                      .+++.++|++.||+|+.-++      ..|++|....+.
T Consensus       153 ~g~s~~EIA~~Lgis~~tV~------~~l~RArk~Lr~  184 (203)
T PRK09647        153 EGLSYEEIAATLGVKLGTVR------SRIHRGRQQLRA  184 (203)
T ss_pred             cCCCHHHHHHHHCCCHHHHH------HHHHHHHHHHHH
Confidence            46788999999998875543      444555444443


No 60 
>cd08311 Death_p75NR Death domain of p75 Neurotophin Receptor. Death Domain (DD) found in p75 neurotrophin receptor (p75NTR, NGFR, TNFRSF16). p75NTR binds members of the neurotrophin (NT) family including nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), and NT3, among others. It contains an NT-binding extracellular region that bears four cysteine-rich repeats, a transmembrane domain, and an intracellular DD. p75NTR plays roles in the immune, vascular, and nervous systems, and has been shown to promote cell death or survival, and to induce neurite outgrowth or collapse depending on its ligands and co-receptors. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptor
Probab=30.21  E-value=91  Score=18.54  Aligned_cols=37  Identities=14%  Similarity=0.165  Sum_probs=28.6

Q ss_pred             CCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHh
Q 046034            9 GLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAK   45 (64)
Q Consensus         9 I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k   45 (64)
                      =+...+++.||+++..+.+..--.+-.+.-+.+|..+
T Consensus        16 ~dW~~LA~~LG~~~~~I~~i~~~~~p~~~lL~~W~~r   52 (77)
T cd08311          16 RDWRSLAGELGYEDEAIDTFGREESPVRTLLADWSAQ   52 (77)
T ss_pred             cCHHHHHHHcCCCHHHHHHHHcChhHHHHHHHHHHHC
Confidence            3568899999999988887766566667778888864


No 61 
>PRK08295 RNA polymerase factor sigma-70; Validated
Probab=30.09  E-value=91  Score=20.13  Aligned_cols=31  Identities=19%  Similarity=0.209  Sum_probs=21.5

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYE   43 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~   43 (64)
                      .+.+.++|++.||+|+..++      ..|+++....+
T Consensus       169 e~~s~~EIA~~lgis~~tV~------~~l~rar~~Lr  199 (208)
T PRK08295        169 DGKSYQEIAEELNRHVKSID------NALQRVKRKLE  199 (208)
T ss_pred             ccCCHHHHHHHHCCCHHHHH------HHHHHHHHHHH
Confidence            36788999999999987765      44555544443


No 62 
>cd04752 Commd4 COMM_Domain containing protein 4. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=29.39  E-value=93  Score=20.80  Aligned_cols=17  Identities=18%  Similarity=0.274  Sum_probs=13.5

Q ss_pred             cCCHHHHHHhc---CCCCch
Q 046034            8 SGLSKEIAKHL---SLPPVK   24 (64)
Q Consensus         8 ~I~~~dI~e~L---gLP~~K   24 (64)
                      .++.+++.+.|   |||+++
T Consensus        59 n~~~~~l~~eL~~lglp~e~   78 (174)
T cd04752          59 NVDGESLSSELQQLGLPKEH   78 (174)
T ss_pred             CCCHHHHHHHHHHcCCCHHH
Confidence            47888888888   899765


No 63 
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=29.15  E-value=32  Score=18.02  Aligned_cols=19  Identities=21%  Similarity=0.141  Sum_probs=11.7

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      .+.+..+|++.+|+++..+
T Consensus        25 ~g~s~~eIa~~l~~s~~~v   43 (54)
T PF08281_consen   25 QGMSYAEIAEILGISESTV   43 (54)
T ss_dssp             S---HHHHHHHCTS-HHHH
T ss_pred             HCcCHHHHHHHHCcCHHHH
Confidence            4578899999999886544


No 64 
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases. Helix-turn-helix-containing domain. Also known as Zab.
Probab=28.60  E-value=43  Score=19.02  Aligned_cols=15  Identities=33%  Similarity=0.514  Sum_probs=12.7

Q ss_pred             CCHHHHHHhcCCCCc
Q 046034            9 GLSKEIAKHLSLPPV   23 (64)
Q Consensus         9 I~~~dI~e~LgLP~~   23 (64)
                      ++..+|++.||++..
T Consensus        23 ~ta~eLa~~lgl~~~   37 (68)
T smart00550       23 STALQLAKNLGLPKK   37 (68)
T ss_pred             cCHHHHHHHHCCCHH
Confidence            888999999999843


No 65 
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are apparently found only in the Planctomycetaceae family including the genuses Gemmata and Pirellula (in which seven sequences are found).
Probab=28.52  E-value=1e+02  Score=19.37  Aligned_cols=19  Identities=11%  Similarity=0.011  Sum_probs=12.1

Q ss_pred             cCCHHHHHHhcCCCCchhH
Q 046034            8 SGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~H   26 (64)
                      +.+.++|++.||+++..++
T Consensus       156 g~s~~eIA~~lgis~~~v~  174 (189)
T TIGR02984       156 GLSFAEVAERMDRSEGAVS  174 (189)
T ss_pred             CCCHHHHHHHHCcCHHHHH
Confidence            4566777777777754443


No 66 
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=28.14  E-value=87  Score=21.98  Aligned_cols=18  Identities=33%  Similarity=0.351  Sum_probs=15.1

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 046034           25 LHCSMLAEDAIKAAVKDY   42 (64)
Q Consensus        25 ~HCA~LA~~ALk~AI~dY   42 (64)
                      ...+.|+.+|.++|+.+.
T Consensus        50 ~~~~~la~~Aa~~aL~~a   67 (329)
T PRK07204         50 ETSSYMGAEAAKKAVEDA   67 (329)
T ss_pred             CCHHHHHHHHHHHHHHHc
Confidence            357889999999999875


No 67 
>PF07759 DUF1615:  Protein of unknown function (DUF1615);  InterPro: IPR011673 This is a family of proteins of unknown function expressed by various bacterial species. Some members of this family (e.g. Q8Z8Z7 from SWISSPROT, Q8ZRF4 from SWISSPROT) are thought to be lipoproteins. Another member of this family (Q93SV8 from SWISSPROT) is thought to be involved in photosynthesis [].
Probab=28.12  E-value=23  Score=26.96  Aligned_cols=21  Identities=33%  Similarity=0.730  Sum_probs=15.3

Q ss_pred             HHHHHhc---CCCCchhH-HHHHHH
Q 046034           12 KEIAKHL---SLPPVKLH-CSMLAE   32 (64)
Q Consensus        12 ~dI~e~L---gLP~~K~H-CA~LA~   32 (64)
                      .||.+.+   |+|+.+-| |++||+
T Consensus        11 ~DI~~af~~~~ip~t~en~CavlAV   35 (319)
T PF07759_consen   11 QDIYTAFEAQGIPPTKENVCAVLAV   35 (319)
T ss_pred             HHHHHHHHhcCCCCCcccccceeee
Confidence            4555555   89988766 998886


No 68 
>TIGR03070 couple_hipB transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems.
Probab=28.11  E-value=53  Score=16.67  Aligned_cols=17  Identities=12%  Similarity=0.135  Sum_probs=13.4

Q ss_pred             HhhcCCHHHHHHhcCCC
Q 046034            5 RNLSGLSKEIAKHLSLP   21 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP   21 (64)
                      +...++..++++.+|++
T Consensus        12 ~~~gltq~~lA~~~gvs   28 (58)
T TIGR03070        12 KALGLTQADLADLAGVG   28 (58)
T ss_pred             HHcCCCHHHHHHHhCCC
Confidence            45678888888888876


No 69 
>PF09339 HTH_IclR:  IclR helix-turn-helix domain;  InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities. One of these subfamilies, called 'iclR', groups several proteins including:  gylR, a possible activator protein for the gylABX glycerol operon in Streptomyces.   iclR, the repressor of the acetate operon (also known as glyoxylate bypass operon) in Escherichia coli and Salmonella typhimurium.    These proteins have a Helix-Turn-Helix motif at the N terminus that is similar to that of other DNA-binding proteins [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1MKM_A 3MQ0_A 3R4K_A 2G7U_C 2O0Y_C 2XRO_F 2XRN_B 2IA2_D.
Probab=28.10  E-value=23  Score=18.86  Aligned_cols=18  Identities=39%  Similarity=0.492  Sum_probs=13.6

Q ss_pred             CCHHHHHHhcCCCCchhH
Q 046034            9 GLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         9 I~~~dI~e~LgLP~~K~H   26 (64)
                      ++-.+|++.+|+|....|
T Consensus        19 ~t~~eia~~~gl~~stv~   36 (52)
T PF09339_consen   19 LTLSEIARALGLPKSTVH   36 (52)
T ss_dssp             EEHHHHHHHHTS-HHHHH
T ss_pred             CCHHHHHHHHCcCHHHHH
Confidence            578899999999966555


No 70 
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=28.02  E-value=59  Score=15.16  Aligned_cols=20  Identities=15%  Similarity=0.180  Sum_probs=14.2

Q ss_pred             HhhcCCHHHHHHhcCCCCch
Q 046034            5 RNLSGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K   24 (64)
                      +...++..++++.+|+++..
T Consensus         7 ~~~~~s~~~la~~~~i~~~~   26 (56)
T smart00530        7 EEKGLTQEELAEKLGVSRST   26 (56)
T ss_pred             HHcCCCHHHHHHHhCCCHHH
Confidence            44567888888888877544


No 71 
>PF14451 Ub-Mut7C:  Mut7-C ubiquitin
Probab=27.98  E-value=32  Score=20.78  Aligned_cols=17  Identities=18%  Similarity=0.417  Sum_probs=13.3

Q ss_pred             CHHHHHHhcCCCCchhH
Q 046034           10 LSKEIAKHLSLPPVKLH   26 (64)
Q Consensus        10 ~~~dI~e~LgLP~~K~H   26 (64)
                      |=+|++|.||+|...++
T Consensus        34 tvkd~IEsLGVP~tEV~   50 (81)
T PF14451_consen   34 TVKDVIESLGVPHTEVG   50 (81)
T ss_pred             cHHHHHHHcCCChHHeE
Confidence            56899999999976543


No 72 
>TIGR02859 spore_sigH RNA polymerase sigma-H factor. Members of this protein family are RNA polymerase sigma-H factor for sporulation in endospore-forming bacteria. This protein is also called Sigma-30 and SigH. Although rather close homologs are detected in Listeria, Listeria does not form spores and the role of the related sigma factor in that genus is in doubt.
Probab=27.84  E-value=1.4e+02  Score=19.03  Aligned_cols=17  Identities=24%  Similarity=0.053  Sum_probs=11.9

Q ss_pred             cCCHHHHHHhcCCCCch
Q 046034            8 SGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K   24 (64)
                      +.+.++|++.||+|...
T Consensus       165 ~~s~~eIA~~l~~s~~t  181 (198)
T TIGR02859       165 GKSYQEIACDLNRHVKS  181 (198)
T ss_pred             CCCHHHHHHHHCCCHHH
Confidence            56777888888877443


No 73 
>PRK12514 RNA polymerase sigma factor; Provisional
Probab=27.52  E-value=1.6e+02  Score=18.59  Aligned_cols=19  Identities=21%  Similarity=0.167  Sum_probs=14.4

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      .+.+.++|++.||+|+.-+
T Consensus       144 ~g~s~~eIA~~lgis~~tV  162 (179)
T PRK12514        144 EGLSYKELAERHDVPLNTM  162 (179)
T ss_pred             cCCCHHHHHHHHCCChHHH
Confidence            3567888888888887665


No 74 
>PRK03814 oxaloacetate decarboxylase subunit gamma; Provisional
Probab=27.28  E-value=58  Score=19.98  Aligned_cols=15  Identities=40%  Similarity=0.341  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHhh
Q 046034           32 EDAIKAAVKDYEAKH   46 (64)
Q Consensus        32 ~~ALk~AI~dY~~k~   46 (64)
                      .-|+.+||..||.++
T Consensus        69 vAAI~AAV~q~R~~~   83 (85)
T PRK03814         69 VAAISAAVHQHRASK   83 (85)
T ss_pred             HHHHHHHHHHHHhhc
Confidence            459999999998875


No 75 
>PRK12527 RNA polymerase sigma factor; Reviewed
Probab=26.69  E-value=1.3e+02  Score=18.59  Aligned_cols=20  Identities=20%  Similarity=0.227  Sum_probs=14.6

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      -+++.++|++.||+|..-++
T Consensus       120 ~~~s~~eIA~~lgis~~tv~  139 (159)
T PRK12527        120 EGLSHQQIAEHLGISRSLVE  139 (159)
T ss_pred             cCCCHHHHHHHhCCCHHHHH
Confidence            45788899999988865443


No 76 
>PRK14384 hypothetical protein; Provisional
Probab=26.12  E-value=59  Score=18.85  Aligned_cols=12  Identities=50%  Similarity=0.733  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHH
Q 046034           26 HCSMLAEDAIKA   37 (64)
Q Consensus        26 HCA~LA~~ALk~   37 (64)
                      -||.++.+||+.
T Consensus         9 TCS~Ya~~Ai~~   20 (56)
T PRK14384          9 SCSCYAETALKR   20 (56)
T ss_pred             cHHHHHHHHHHH
Confidence            599999999853


No 77 
>PRK12531 RNA polymerase sigma factor; Provisional
Probab=25.71  E-value=1.4e+02  Score=19.30  Aligned_cols=18  Identities=11%  Similarity=0.207  Sum_probs=12.5

Q ss_pred             cCCHHHHHHhcCCCCchh
Q 046034            8 SGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~   25 (64)
                      +++.++|++.||+|..-+
T Consensus       157 g~s~~EIA~~lgis~~tV  174 (194)
T PRK12531        157 ELPHQQVAEMFDIPLGTV  174 (194)
T ss_pred             CCCHHHHHHHhCcCHHHH
Confidence            567778888887775443


No 78 
>PF09077 Phage-MuB_C:  Mu B transposition protein, C terminal ;  InterPro: IPR009084  Bacteriophage Mu can integrate into the host bacterial genome and replicate via transposition. Mu requires the activity of four proteins for DNA transposition. Two of these proteins are the phage-encoded A and B transposition proteins, while the other two are host-specified accessory factors HU and IHF. These four proteins can form nucleoprotein complexes (transposomes), which enable strand transfer. The stable protein-DNA intermediate is subsequently disassembled prior to DNA replication by host proteins. The Mu B transposition protein is an ATP-dependent, DNA-binding protein required for target capture and immunity, as well as for activating transpososome function []. The C-terminal domain of the B transposition protein is believed to be involved in both DNA-binding and protein-protein contacts with the Mu A transposition protein. The structure of the C-terminal domain consists of four helices in an irregular array [].; GO: 0003677 DNA binding, 0006313 transposition, DNA-mediated; PDB: 1F6V_A.
Probab=25.58  E-value=40  Score=20.57  Aligned_cols=20  Identities=30%  Similarity=0.157  Sum_probs=17.2

Q ss_pred             hhHHhhcCCHHHHHHhc-CCC
Q 046034            2 ANLRNLSGLSKEIAKHL-SLP   21 (64)
Q Consensus         2 ~~~EA~~I~~~dI~e~L-gLP   21 (64)
                      |+.+||.|++++...+| ++-
T Consensus        19 Ai~~AWgI~d~~~~~~l~~I~   39 (78)
T PF09077_consen   19 AIAKAWGITDKEERKLLQSIA   39 (78)
T ss_dssp             HHHHSSSSSSSHHHHHHHTTS
T ss_pred             HHHHHhCCCCHHHHHHHHHHc
Confidence            67899999999999999 554


No 79 
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional
Probab=25.55  E-value=93  Score=21.96  Aligned_cols=17  Identities=24%  Similarity=0.247  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 046034           26 HCSMLAEDAIKAAVKDY   42 (64)
Q Consensus        26 HCA~LA~~ALk~AI~dY   42 (64)
                      ..+.|+..|+++|+.+.
T Consensus        50 ~~~~la~~A~~~aL~~a   66 (326)
T CHL00203         50 SLTKLAAEAANKALDKA   66 (326)
T ss_pred             CHHHHHHHHHHHHHHHc
Confidence            46899999999999885


No 80 
>PRK14382 hypothetical protein; Provisional
Probab=25.52  E-value=59  Score=19.30  Aligned_cols=13  Identities=31%  Similarity=0.312  Sum_probs=10.6

Q ss_pred             hHHHHHHHHHHHH
Q 046034           25 LHCSMLAEDAIKA   37 (64)
Q Consensus        25 ~HCA~LA~~ALk~   37 (64)
                      --||.++.+|++.
T Consensus        28 PTCS~Ya~~Ai~~   40 (68)
T PRK14382         28 PTCSTYAILSIEK   40 (68)
T ss_pred             cCHHHHHHHHHHH
Confidence            4599999999853


No 81 
>PF11212 DUF2999:  Protein of unknown function (DUF2999);  InterPro: IPR021376  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=25.49  E-value=31  Score=21.46  Aligned_cols=16  Identities=25%  Similarity=0.374  Sum_probs=11.6

Q ss_pred             HHHHhcCCCCchhHHH
Q 046034           13 EIAKHLSLPPVKLHCS   28 (64)
Q Consensus        13 dI~e~LgLP~~K~HCA   28 (64)
                      .++..||+|++|+.--
T Consensus        34 a~i~qLGip~eKLQ~l   49 (82)
T PF11212_consen   34 ATIQQLGIPQEKLQQL   49 (82)
T ss_pred             HHHHHcCCCHHHHHHH
Confidence            3455679999998743


No 82 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=25.26  E-value=76  Score=18.11  Aligned_cols=16  Identities=25%  Similarity=0.532  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHhhC
Q 046034           32 EDAIKAAVKDYEAKHT   47 (64)
Q Consensus        32 ~~ALk~AI~dY~~k~~   47 (64)
                      -.+||.+|..|..++.
T Consensus        57 n~~Lk~~I~~~~~~~~   72 (73)
T PF04564_consen   57 NRALKSAIEEWCAENK   72 (73)
T ss_dssp             -HHHHHHHHHHHHHCT
T ss_pred             CHHHHHHHHHHHHHcc
Confidence            4689999999998864


No 83 
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1. Death domain (DD) found in Receptor-Interacting Protein 1 (RIP1) and related proteins. RIP kinases serve as essential sensors of cellular stress. Vertebrates contain several types containing a homologous N-terminal kinase domain and varying C-terminal domains. RIP1 harbors a C-terminal DD, which binds death receptors (DRs) including TNF receptor 1, Fas, TNF-related apoptosis-inducing ligand receptor 1 (TRAILR1), and TRAILR2. It also interacts with other DD-containing adaptor proteins such as TRADD and FADD. RIP1 plays a crucial role in determining a cell's fate, between survival or death, following exposure to stress signals. It is important in the signaling of NF-kappaB and MAPKs, and it links DR-associated signaling to reactive oxygen species (ROS) production. Abnormal RIP1 function may result in ROS accumulation affecting inflammatory responses, innate immunity, stress responses, and cell survival. In general, DDs ar
Probab=25.09  E-value=1.6e+02  Score=17.62  Aligned_cols=43  Identities=14%  Similarity=0.203  Sum_probs=31.1

Q ss_pred             HhhcCCHHHHHHhcCCCCchhHHHHHH------HHHHHHHHHHHHHhhC
Q 046034            5 RNLSGLSKEIAKHLSLPPVKLHCSMLA------EDAIKAAVKDYEAKHT   47 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K~HCA~LA------~~ALk~AI~dY~~k~~   47 (64)
                      +-+.=+++.++..||+++..+....--      .+..+..+..|+.+.+
T Consensus        10 ~~lG~~Wk~lar~LG~s~~eI~~ie~~~~r~~~~eq~~~mL~~W~~r~g   58 (86)
T cd08777          10 ENLGKKWKRCARKLGFTESEIEEIDHDYERDGLKEKVHQMLHKWKMKEG   58 (86)
T ss_pred             HHHHHHHHHHHHHcCCCHHHHHHHHHhcccCCHHHHHHHHHHHHHHccC
Confidence            344557889999999999888776533      3456777778877654


No 84 
>PRK09047 RNA polymerase factor sigma-70; Validated
Probab=25.08  E-value=1.4e+02  Score=18.22  Aligned_cols=20  Identities=10%  Similarity=-0.100  Sum_probs=14.3

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+++.++|++.||+|+..++
T Consensus       121 ~g~s~~EIA~~lgis~~tV~  140 (161)
T PRK09047        121 EDMDVAETAAAMGCSEGSVK  140 (161)
T ss_pred             hcCCHHHHHHHHCCCHHHHH
Confidence            45778888888888765543


No 85 
>PHA01976 helix-turn-helix protein
Probab=25.06  E-value=62  Score=17.47  Aligned_cols=18  Identities=6%  Similarity=0.060  Sum_probs=13.4

Q ss_pred             HhhcCCHHHHHHhcCCCC
Q 046034            5 RNLSGLSKEIAKHLSLPP   22 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~   22 (64)
                      +...|+-.++++.+|+++
T Consensus        12 ~~~glt~~~lA~~~gvs~   29 (67)
T PHA01976         12 NARAWSAPELSRRAGVRH   29 (67)
T ss_pred             HHcCCCHHHHHHHhCCCH
Confidence            456788888888887773


No 86 
>PF03131 bZIP_Maf:  bZIP Maf transcription factor;  InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell. MafG and MafH are small Mafs which lack a putative transactivation domain. They behave as transcriptional repressors when they dimerize among themselves. However they also serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Maf transcription factors contain a conserved basic region leucine zipper (bZIP) domain, which mediates their dimerization and DNA binding property. Neural retina-specific leucine zipper proteins also belong to this family. Together with the basic region, the Maf extended homology region (EHR), conserved only within the Maf family, defines the DNA binding specific to Mafs. This structure enables Mafs to make a broader area of contact with DNA and to recognise longer DNA sequences. In particular, the two residues at the beginning of helix H2 are positioned to recognise the flanking region []. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF2-E2 transcription factor.  In mouse, Maf1 may play an early role in axial patterning. Defects in these proteins are a cause of autosomal dominant retinitis pigmentosa. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2KZ5_A 3A5T_A 1K1V_A 1SKN_P 2WT7_B 2WTY_B.
Probab=24.84  E-value=49  Score=19.94  Aligned_cols=28  Identities=14%  Similarity=0.112  Sum_probs=20.3

Q ss_pred             ChhHHhhcCCHHHHHHhc-CCCCchhHHH
Q 046034            1 MANLRNLSGLSKEIAKHL-SLPPVKLHCS   28 (64)
Q Consensus         1 ~~~~EA~~I~~~dI~e~L-gLP~~K~HCA   28 (64)
                      +.+++...|+-.+.-..| |||++.+.-.
T Consensus         1 ~s~eeL~~m~v~efn~~L~~lt~~q~~~l   29 (92)
T PF03131_consen    1 FSDEELVSMSVREFNRLLRGLTEEQIAEL   29 (92)
T ss_dssp             --HHHHHHS-HHHHHHHCTTS-HHHHHHH
T ss_pred             CCHHHHhhCCHHHHHHHHHcCCHHHHHHH
Confidence            356888999999999999 9998886643


No 87 
>TIGR00673 cynS cyanate hydratase. Alternate names include cyanate lyase, cyanase and cyanate hydrolase.
Probab=24.66  E-value=59  Score=22.10  Aligned_cols=27  Identities=19%  Similarity=0.191  Sum_probs=20.6

Q ss_pred             HhhcCCHHHHHHhcCCCCchhHHHHHH
Q 046034            5 RNLSGLSKEIAKHLSLPPVKLHCSMLA   31 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K~HCA~LA   31 (64)
                      ...++|.++|++.+|++++-..=+.|+
T Consensus        18 ~~KGLTwe~IAe~iG~sevwvaaa~lG   44 (150)
T TIGR00673        18 KKKGLTFADIADGLGLAEVFVAAALYG   44 (150)
T ss_pred             HHcCCCHHHHHHHHCCCHHHHHHHHhC
Confidence            467899999999999887665555554


No 88 
>smart00005 DEATH DEATH domain, found in proteins involved in cell death (apoptosis). Alpha-helical domain present in a variety of proteins with apoptotic functions. Some (but not all) of these domains form homotypic and heterotypic dimers.
Probab=24.55  E-value=1.4e+02  Score=16.79  Aligned_cols=41  Identities=15%  Similarity=0.158  Sum_probs=29.1

Q ss_pred             cCCHHHHHHhcCCCCchhHHHHHHH-----HHHHHHHHHHHHhhCC
Q 046034            8 SGLSKEIAKHLSLPPVKLHCSMLAE-----DAIKAAVKDYEAKHTK   48 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~HCA~LA~-----~ALk~AI~dY~~k~~~   48 (64)
                      .-+...++..||++...+.+...-.     +-...-+..|+.+.+.
T Consensus        17 g~~W~~la~~Lg~~~~~i~~i~~~~~~~~~~~~~~lL~~W~~~~g~   62 (88)
T smart00005       17 GLDWRELARKLGLSEADIDQIRTEAPRDLAEQSVQLLRLWEQREGK   62 (88)
T ss_pred             chHHHHHHHHcCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHccch
Confidence            4467788999999877776655554     4666777788777653


No 89 
>PF08513 LisH:  LisH;  InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions. The recently solved structure of the LisH domain in the N-terminal region of LIS1 depicted it as a novel dimerization motif, and that other structural elements are likely to play an important role in dimerisation [, , ].  The LisH (lis homology) domain mediates protein dimerisation and tetramerisation. The LisH domain is found in Sif2, a component of the Set3 complex which is responsible for repressing meiotic genes. It has been shown that the LisH domain helps mediate interaction with components of the Set3 complex []. ; PDB: 2XTE_L 2XTC_B 2XTD_A 1UUJ_B.
Probab=24.54  E-value=82  Score=15.08  Aligned_cols=15  Identities=13%  Similarity=0.275  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHhhCCC
Q 046034           35 IKAAVKDYEAKHTKS   49 (64)
Q Consensus        35 Lk~AI~dY~~k~~~~   49 (64)
                      |...|.+|..+.+-.
T Consensus         3 Ln~lI~~YL~~~Gy~   17 (27)
T PF08513_consen    3 LNQLIYDYLVENGYK   17 (27)
T ss_dssp             HHHHHHHHHHHCT-H
T ss_pred             HHHHHHHHHHHCCcH
Confidence            677899999887643


No 90 
>PF01978 TrmB:  Sugar-specific transcriptional regulator TrmB;  InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis. TrmB has been shown to be a maltose-specific repressor, and this inhibition is counteracted by maltose and trehalose. TrmB binds maltose and trehalose half-maximally at 20 uM and 0.5 mM sugar concentration, respectively []. Other members of this family are annotated as either transcriptional regulators or hypothetical proteins. ; PDB: 2D1H_A 3QPH_A 1SFX_A.
Probab=24.45  E-value=30  Score=19.09  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=14.3

Q ss_pred             cCCHHHHHHhcCCCCchh
Q 046034            8 SGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~   25 (64)
                      ..|..+|++.+|+|..++
T Consensus        22 ~~t~~eIa~~l~i~~~~v   39 (68)
T PF01978_consen   22 PATAEEIAEELGISRSTV   39 (68)
T ss_dssp             HEEHHHHHHHHTSSHHHH
T ss_pred             CCCHHHHHHHHCcCHHHH
Confidence            467889999999995554


No 91 
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found primarily in the genus Bacteroides. This family appears to have resulted from a lineage-specific expansion as B. thetaiotaomicron VPI-5482, Bacteroides forsythus ATCC 43037, Bacteroides fragilis YCH46 and Bacteroides fragilis NCTC 9343 contain 25, 12, 24 and 23 members, respectively. There are currentlyonly two known members of this family outside of the Bacteroides, in Rhodopseudomonas and Bradyrhizobium.
Probab=23.97  E-value=1.5e+02  Score=17.83  Aligned_cols=18  Identities=28%  Similarity=0.300  Sum_probs=12.4

Q ss_pred             cCCHHHHHHhcCCCCchh
Q 046034            8 SGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~   25 (64)
                      .++..+|++.||+|+.-+
T Consensus       129 ~~~~~eIA~~lgis~~tv  146 (161)
T TIGR02985       129 GKSYKEIAEELGISVKTV  146 (161)
T ss_pred             CCCHHHHHHHHCCCHHHH
Confidence            567777887777775543


No 92 
>PF04967 HTH_10:  HTH DNA binding domain;  InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. This entry represents the HTH DNA binding domain found in Halobacterium salinarium (Halobacterium halobium) and described as a putative bacterio-opsin activator. 
Probab=23.84  E-value=1.3e+02  Score=16.76  Aligned_cols=19  Identities=16%  Similarity=0.163  Sum_probs=14.7

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      ..++-++|++.||+++.-+
T Consensus        22 R~~tl~elA~~lgis~st~   40 (53)
T PF04967_consen   22 RRITLEELAEELGISKSTV   40 (53)
T ss_pred             CcCCHHHHHHHhCCCHHHH
Confidence            3678899999999885443


No 93 
>COG1229 FwdA Formylmethanofuran dehydrogenase subunit A [Energy production and conversion]
Probab=23.63  E-value=29  Score=28.06  Aligned_cols=26  Identities=35%  Similarity=0.687  Sum_probs=19.4

Q ss_pred             hcCCHHHHH-------HhcCCC-CchhHHHHHHH
Q 046034            7 LSGLSKEIA-------KHLSLP-PVKLHCSMLAE   32 (64)
Q Consensus         7 ~~I~~~dI~-------e~LgLP-~~K~HCA~LA~   32 (64)
                      ++||+.+|+       |.|||| .-++||-.|+.
T Consensus       210 FdiTP~EIi~glaevnE~L~lphsIHlH~N~LG~  243 (575)
T COG1229         210 FDITPREIIKGLAEVNERLGLPHSIHLHCNNLGH  243 (575)
T ss_pred             cccCHHHHHHHHHHHHHhhCCCcceEeccccCCC
Confidence            467777765       455899 77999999874


No 94 
>PRK09648 RNA polymerase sigma factor SigD; Reviewed
Probab=23.61  E-value=1.5e+02  Score=18.91  Aligned_cols=19  Identities=16%  Similarity=0.151  Sum_probs=13.9

Q ss_pred             cCCHHHHHHhcCCCCchhH
Q 046034            8 SGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~H   26 (64)
                      +.+.++|++.||+|+..+.
T Consensus       155 g~s~~EIA~~lgis~~tV~  173 (189)
T PRK09648        155 GLSAEETAEAVGSTPGAVR  173 (189)
T ss_pred             CCCHHHHHHHHCCCHHHHH
Confidence            5677888888888865544


No 95 
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor. Members of this family comprise the Firmicutes lineage endospore formation-specific sigma factor SigE, also called SpoIIGB and sigma-29. As characterized in Bacillus subtilis, this protein is synthesized as a precursor, specifically in the mother cell compartment, and must cleaved by the SpoIIGA protein to be made active.
Probab=23.58  E-value=1.4e+02  Score=20.21  Aligned_cols=18  Identities=22%  Similarity=0.309  Sum_probs=14.6

Q ss_pred             cCCHHHHHHhcCCCCchh
Q 046034            8 SGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~   25 (64)
                      +.+.++|++.||+|+..+
T Consensus       198 g~s~~EIA~~Lgis~~tV  215 (234)
T TIGR02835       198 EKTQKEVADMLGISQSYI  215 (234)
T ss_pred             CCCHHHHHHHHCCCHHHH
Confidence            478889999999887765


No 96 
>PF00666 Cathelicidins:  Cathelicidin;  InterPro: IPR001894 The precursor sequences of a number of antimicrobial peptides secreted by neutrophils (polymorphonuclear leukocytes) upon activation have been found to be evolutionarily related and are collectively known as cathelicidins []. Structurally, these proteins consist of three domains: a signal sequence, a conserved region of about 100 residues that contains four cysteines involved in two disulphide bonds, and a highly divergent C-terminal section of variable size. It is in this C-terminal section that the antibacterial peptides are found; they are proteolytically processed from their precursor by enzymes such as elastase. This structure is shown in the following schematic representation:  +---+--------------------------------+--------------------+ |Sig| Propeptide C C C C | Antibacterial pep. | +---+----------------|--|--|--|------+--------------------+ | | | | +--+ +--+ 'C': conserved cysteine involved in a disulphide bond. ; GO: 0006952 defense response, 0005576 extracellular region; PDB: 1KWI_A 1PFP_A 1LXE_A 1N5P_A 1N5H_A.
Probab=23.51  E-value=88  Score=18.60  Aligned_cols=19  Identities=26%  Similarity=0.345  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHhhCCCc
Q 046034           32 EDAIKAAVKDYEAKHTKSS   50 (64)
Q Consensus        32 ~~ALk~AI~dY~~k~~~~~   50 (64)
                      .+|+..||..|-.++...+
T Consensus         5 ~eav~~Av~~yN~~s~~~n   23 (67)
T PF00666_consen    5 EEAVLRAVDFYNQGSSGEN   23 (67)
T ss_dssp             HHHHHHHHHHHHHCS-SSE
T ss_pred             HHHHHHHHHHHhcCCCccC
Confidence            4789999999988866543


No 97 
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.
Probab=23.45  E-value=1.9e+02  Score=17.80  Aligned_cols=18  Identities=11%  Similarity=0.025  Sum_probs=13.0

Q ss_pred             hcCCHHHHHHhcCCCCch
Q 046034            7 LSGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K   24 (64)
                      .+.+.++|++.||+|..-
T Consensus       125 ~g~s~~eIA~~lgis~~t  142 (162)
T TIGR02983       125 EDLSEAQVAEALGISVGT  142 (162)
T ss_pred             hcCCHHHHHHHhCCCHHH
Confidence            357788888888887544


No 98 
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor. This sigma factor is restricted to certain lineages of the order Bacillales.
Probab=23.40  E-value=1.6e+02  Score=18.50  Aligned_cols=20  Identities=30%  Similarity=0.227  Sum_probs=13.9

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+++..+.
T Consensus       151 ~g~s~~eIA~~lgis~~~v~  170 (187)
T TIGR02948       151 EDLSLKEISEILDLPVGTVK  170 (187)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            35677888888888765543


No 99 
>PRK12547 RNA polymerase sigma factor; Provisional
Probab=23.35  E-value=1.8e+02  Score=18.22  Aligned_cols=19  Identities=5%  Similarity=-0.216  Sum_probs=13.6

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      .+++.++|++.||+|+.-+
T Consensus       127 ~g~s~~eIA~~lgis~~tV  145 (164)
T PRK12547        127 SGFSYEDAAAICGCAVGTI  145 (164)
T ss_pred             cCCCHHHHHHHhCCCHHHH
Confidence            4577888888888876443


No 100
>PF14106 DUF4279:  Domain of unknown function (DUF4279)
Probab=23.25  E-value=44  Score=20.09  Aligned_cols=19  Identities=21%  Similarity=0.258  Sum_probs=15.0

Q ss_pred             cCCHHHHHHhcCCCCchhH
Q 046034            8 SGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~H   26 (64)
                      .++.++|.+.||+.|.+.+
T Consensus         5 ~~~p~eiT~~Lgi~Pt~~~   23 (118)
T PF14106_consen    5 DFDPDEITRLLGIEPTETW   23 (118)
T ss_pred             CCCHHHHHHHHCCCceEEE
Confidence            4677888888888888766


No 101
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor. The sporulation-specific transcription factor sigma-K (also called sigma-27) is expressed in the mother cell compartment of endospore-forming bacteria such as Bacillus subtilis. Like its close homolog sigma-E (sigma-29) (see TIGR02835), also specific to the mother cell compartment, it must be activated by a proteolytic cleavage. Note that in Bacillus subtilis (and apparently also Clostridium tetani), but not in other endospore forming species such as Bacillus anthracis, the sigK gene is generated by a non-germline (mother cell only) chromosomal rearrangement that recombines coding regions for the N-terminal and C-terminal regions of sigma-K.
Probab=23.14  E-value=1.3e+02  Score=20.22  Aligned_cols=19  Identities=26%  Similarity=0.291  Sum_probs=15.9

Q ss_pred             cCCHHHHHHhcCCCCchhH
Q 046034            8 SGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~H   26 (64)
                      +++.++|++.||+|+..+.
T Consensus       194 ~~S~~EIAe~lgis~~tV~  212 (227)
T TIGR02846       194 RKTQREIAKILGISRSYVS  212 (227)
T ss_pred             CcCHHHHHHHHCCCHHHHH
Confidence            4689999999999988773


No 102
>PRK09642 RNA polymerase sigma factor SigW; Reviewed
Probab=23.10  E-value=1.9e+02  Score=17.77  Aligned_cols=19  Identities=16%  Similarity=0.018  Sum_probs=14.0

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      .+++.++|++.||+|+.-+
T Consensus       121 ~g~s~~EIA~~lgis~~tV  139 (160)
T PRK09642        121 EEKSYQEIALQEKIEVKTV  139 (160)
T ss_pred             hCCCHHHHHHHHCCCHHHH
Confidence            4577888888888886554


No 103
>PRK12543 RNA polymerase sigma factor; Provisional
Probab=22.86  E-value=1.9e+02  Score=18.39  Aligned_cols=20  Identities=25%  Similarity=0.247  Sum_probs=15.4

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+++.++|++.||+|...++
T Consensus       132 e~~s~~EIA~~lgis~~tV~  151 (179)
T PRK12543        132 HDYSQEEIAQLLQIPIGTVK  151 (179)
T ss_pred             ccCCHHHHHHHHCCCHHHHH
Confidence            45788899999999866554


No 104
>PRK10046 dpiA two-component response regulator DpiA; Provisional
Probab=22.77  E-value=77  Score=20.84  Aligned_cols=24  Identities=13%  Similarity=0.162  Sum_probs=17.7

Q ss_pred             cCCHHHHHHhcCCCC--chhHHHHHH
Q 046034            8 SGLSKEIAKHLSLPP--VKLHCSMLA   31 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~--~K~HCA~LA   31 (64)
                      ..++++|++.||+.+  .+.|=+.|.
T Consensus       177 g~s~~eIa~~l~iS~~Tv~~~~~~~~  202 (225)
T PRK10046        177 QHTAETVAQALTISRTTARRYLEYCA  202 (225)
T ss_pred             CcCHHHHHHHhCccHHHHHHHHHHHH
Confidence            368999999999987  566654443


No 105
>PRK14390 hypothetical protein; Provisional
Probab=22.76  E-value=73  Score=18.74  Aligned_cols=13  Identities=31%  Similarity=0.417  Sum_probs=10.4

Q ss_pred             hHHHHHHHHHHHH
Q 046034           25 LHCSMLAEDAIKA   37 (64)
Q Consensus        25 ~HCA~LA~~ALk~   37 (64)
                      --||.+|.+|++.
T Consensus        21 PTCS~Ya~~Ai~~   33 (63)
T PRK14390         21 PSCSSYGYEAITR   33 (63)
T ss_pred             ccHHHHHHHHHHH
Confidence            3599999999853


No 106
>PRK12526 RNA polymerase sigma factor; Provisional
Probab=22.70  E-value=1.7e+02  Score=19.30  Aligned_cols=30  Identities=13%  Similarity=0.293  Sum_probs=18.7

Q ss_pred             cCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHH
Q 046034            8 SGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYE   43 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~   43 (64)
                      +++.++|++.||+++..+      ...|++|+..-+
T Consensus       169 g~s~~EIA~~lgis~~tV------~~~l~Ra~~~Lr  198 (206)
T PRK12526        169 ELSQEQLAQQLNVPLGTV------KSRLRLALAKLK  198 (206)
T ss_pred             CCCHHHHHHHHCCCHHHH------HHHHHHHHHHHH
Confidence            577888888888875544      344455554443


No 107
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoE. This protein may be called sigma-24, sigma-E factor, sigma-H factor, fecI-like sigma factor or alternative sigma factor AlgU.
Probab=22.68  E-value=1.6e+02  Score=18.58  Aligned_cols=20  Identities=15%  Similarity=0.115  Sum_probs=14.9

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+++..+.
T Consensus       153 ~~~s~~EIA~~lgis~~tv~  172 (190)
T TIGR02939       153 EGLSYEDIARIMDCPVGTVR  172 (190)
T ss_pred             cCCCHHHHHHHHCcCHHHHH
Confidence            45778899999988865543


No 108
>PRK04217 hypothetical protein; Provisional
Probab=22.65  E-value=1.8e+02  Score=18.53  Aligned_cols=36  Identities=8%  Similarity=0.025  Sum_probs=24.8

Q ss_pred             hcCCHHHHHHhcCCCCchhHHH-HHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCS-MLAEDAIKAAVKDY   42 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA-~LA~~ALk~AI~dY   42 (64)
                      ..++.++|++.||++..-++-. .-+.+.|+..+...
T Consensus        57 eGlS~~EIAk~LGIS~sTV~r~L~RArkkLre~L~~~   93 (110)
T PRK04217         57 EGLTQEEAGKRMGVSRGTVWRALTSARKKVAQMLVEG   93 (110)
T ss_pred             cCCCHHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHhc
Confidence            3578999999999997776644 33555565555443


No 109
>cd00336 Ribosomal_L22 Ribosomal protein L22/L17e.  L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit.  It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper folding and stabilizing the conformation of 23S rRNA.  L22 is the largest protein contributor to the surface of the polypeptide exit channel, the tunnel through which the polypeptide product passes.  L22 is also one of six proteins located at the putative translocon binding site on the exterior surface of the ribosome.
Probab=22.54  E-value=71  Score=19.44  Aligned_cols=39  Identities=15%  Similarity=0.115  Sum_probs=26.0

Q ss_pred             CHHHHHHhc-CCCCchhHHHHHHHHHHHHHHHHHHHhhCC
Q 046034           10 LSKEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKHTK   48 (64)
Q Consensus        10 ~~~dI~e~L-gLP~~K~HCA~LA~~ALk~AI~dY~~k~~~   48 (64)
                      .+..+-+++ -|.-....++.+-.++|+.|+.++..+...
T Consensus        23 rg~~v~~A~~~L~~~~kk~a~~i~k~l~sa~~nA~~~~~~   62 (105)
T cd00336          23 RGMSVDEALAQLEFVPKKAAKIILKLLKSAEANAENNGLD   62 (105)
T ss_pred             cCCcHHHHHHHHHhCCHHHHHHHHHHHHHHHHhHHHcCCC
Confidence            333344444 233334677899999999999999876554


No 110
>PRK09641 RNA polymerase sigma factor SigW; Provisional
Probab=22.45  E-value=1.6e+02  Score=18.52  Aligned_cols=19  Identities=32%  Similarity=0.228  Sum_probs=13.6

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      .+.+.++|++.||+++..+
T Consensus       151 ~~~s~~eIA~~lgis~~~v  169 (187)
T PRK09641        151 EDLSLKEISEILDLPVGTV  169 (187)
T ss_pred             hCCCHHHHHHHHCCCHHHH
Confidence            3567788888888886554


No 111
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon
Probab=22.36  E-value=69  Score=15.85  Aligned_cols=19  Identities=26%  Similarity=0.267  Sum_probs=13.7

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      -..+..+|++.||+++..+
T Consensus        17 ~g~s~~eia~~l~is~~tv   35 (58)
T smart00421       17 EGLTNKEIAERLGISEKTV   35 (58)
T ss_pred             cCCCHHHHHHHHCCCHHHH
Confidence            3578888998888775443


No 112
>TIGR01195 oadG_fam sodium pump decarboxylases, gamma subunit. Most sequences scoring between the noise and trusted cutoffs are eukaryotic sodium channel proteins.
Probab=22.31  E-value=71  Score=19.22  Aligned_cols=14  Identities=43%  Similarity=0.347  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHhh
Q 046034           33 DAIKAAVKDYEAKH   46 (64)
Q Consensus        33 ~ALk~AI~dY~~k~   46 (64)
                      -++-.||..|+.++
T Consensus        68 AaIsAAI~~~r~~~   81 (82)
T TIGR01195        68 AAIAAAVHEHLRKT   81 (82)
T ss_pred             HHHHHHHHHHHHcc
Confidence            49999999998875


No 113
>PRK09640 RNA polymerase sigma factor SigX; Reviewed
Probab=22.28  E-value=2e+02  Score=18.49  Aligned_cols=20  Identities=15%  Similarity=-0.027  Sum_probs=14.6

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      .+.+.++|++.||+|..-+.
T Consensus       149 ~g~s~~EIA~~lgis~~tV~  168 (188)
T PRK09640        149 AELEFQEIADIMHMGLSATK  168 (188)
T ss_pred             cCCCHHHHHHHHCCCHHHHH
Confidence            35788899998888865443


No 114
>PRK11470 hypothetical protein; Provisional
Probab=22.26  E-value=75  Score=22.36  Aligned_cols=25  Identities=20%  Similarity=0.134  Sum_probs=20.5

Q ss_pred             CCCchhHHHHHHHHHHHHHHHHHHH
Q 046034           20 LPPVKLHCSMLAEDAIKAAVKDYEA   44 (64)
Q Consensus        20 LP~~K~HCA~LA~~ALk~AI~dY~~   44 (64)
                      +-..++.||.|..++.+.|..-...
T Consensus       111 ~~d~~~YCSElV~~~y~~a~~i~vg  135 (200)
T PRK11470        111 YESSRQFCSKFVFDIYKEALCIPVG  135 (200)
T ss_pred             CCCCceehHHHHHHHHHHhhCCccc
Confidence            5678999999999999999854443


No 115
>PRK12533 RNA polymerase sigma factor; Provisional
Probab=22.13  E-value=1.6e+02  Score=19.98  Aligned_cols=19  Identities=21%  Similarity=0.104  Sum_probs=15.2

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      ..++.++|++.||+|+.-+
T Consensus       149 eg~s~~EIAe~LgiS~~tV  167 (216)
T PRK12533        149 EDMSYREIAAIADVPVGTV  167 (216)
T ss_pred             cCCCHHHHHHHHCCCHHHH
Confidence            4678999999999886554


No 116
>TIGR03879 near_KaiC_dom probable regulatory domain. This model describes a common domain shared by two different families of proteins, each of which occurs regularly next to its corresponding partner family, a probable regulatory with homology to KaiC. By implication, this protein family likely is also involved in sensory transduction and/or regulation.
Probab=22.03  E-value=64  Score=19.39  Aligned_cols=19  Identities=21%  Similarity=0.209  Sum_probs=14.9

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      ..++..+|++.||+++..+
T Consensus        31 eGlS~kEIAe~LGIS~~TV   49 (73)
T TIGR03879        31 AGKTASEIAEELGRTEQTV   49 (73)
T ss_pred             cCCCHHHHHHHHCcCHHHH
Confidence            4678899999999886543


No 117
>TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR. Similarly, tetanus toxin production of Clostridium tetani is regulated by TetR which is a very close relative of BotR. Both BotR and TetR are members of the TIGR02937 subfamily of sigma-70 RNA polymerase sigma factors. Functional complementation experiments have been done for botR and tetR in highly transformable strain of Clostridium perfringens host cells to assess functional interchangeability of sigma factors and it has been confirmed that they are interchangeable in vivo.
Probab=22.02  E-value=62  Score=19.78  Aligned_cols=18  Identities=22%  Similarity=0.147  Sum_probs=13.6

Q ss_pred             hcCCHHHHHHhcCCCCch
Q 046034            7 LSGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K   24 (64)
                      .+++.++|++.||+|+.-
T Consensus       122 ~~~s~~EIA~~l~is~~t  139 (142)
T TIGR03209       122 EDMKEIDIAKKLHISRQS  139 (142)
T ss_pred             cCCCHHHHHHHHCcCHHh
Confidence            357888999998888643


No 118
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription]
Probab=22.02  E-value=1.8e+02  Score=18.61  Aligned_cols=32  Identities=19%  Similarity=0.123  Sum_probs=20.1

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEA   44 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~   44 (64)
                      .+++..+|++.||+|...++      ..|+.|...-+.
T Consensus       142 ~gls~~EIA~~l~i~~~tVk------s~l~ra~~~l~~  173 (182)
T COG1595         142 EGLSYEEIAEILGISVGTVK------SRLHRARKKLRE  173 (182)
T ss_pred             cCCCHHHHHHHHCCCHHHHH------HHHHHHHHHHHH
Confidence            46788888888888855543      445555544433


No 119
>PF07308 DUF1456:  Protein of unknown function (DUF1456);  InterPro: IPR009921 This domain occurs in several hypothetical bacterial proteins of around 150 residues in length. The function of this domain is unknown.
Probab=21.99  E-value=1.4e+02  Score=17.41  Aligned_cols=20  Identities=10%  Similarity=0.079  Sum_probs=13.9

Q ss_pred             HhhcCCHHHHHHhc---CCCCch
Q 046034            5 RNLSGLSKEIAKHL---SLPPVK   24 (64)
Q Consensus         5 EA~~I~~~dI~e~L---gLP~~K   24 (64)
                      -|++|++++|++.+   |.+-.+
T Consensus        10 yal~l~d~~m~~if~l~~~~vs~   32 (68)
T PF07308_consen   10 YALDLKDDDMIEIFALAGFEVSK   32 (68)
T ss_pred             HHHcCChHHHHHHHHHcCCccCH
Confidence            47788888888887   444433


No 120
>PF06531 DUF1108:  Protein of unknown function (DUF1108);  InterPro: IPR009494 This entry is represented by Bacteriophage 92, Orf49. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several bacterial proteins from Staphylococcus aureus as well as a number of phage proteins. The function of this family is unknown.
Probab=21.98  E-value=1.2e+02  Score=19.09  Aligned_cols=24  Identities=21%  Similarity=0.267  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhCCC
Q 046034           26 HCSMLAEDAIKAAVKDYEAKHTKS   49 (64)
Q Consensus        26 HCA~LA~~ALk~AI~dY~~k~~~~   49 (64)
                      .=-..|.+.|++||.+|-..+.++
T Consensus        52 sdl~~A~d~i~~aiyewIE~nTDE   75 (86)
T PF06531_consen   52 SDLYIAMDIINQAIYEWIEENTDE   75 (86)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCcch
Confidence            334578999999999999887654


No 121
>PRK14373 hypothetical protein; Provisional
Probab=21.81  E-value=77  Score=19.13  Aligned_cols=13  Identities=38%  Similarity=0.554  Sum_probs=10.5

Q ss_pred             hHHHHHHHHHHHH
Q 046034           25 LHCSMLAEDAIKA   37 (64)
Q Consensus        25 ~HCA~LA~~ALk~   37 (64)
                      --||.++.+|++.
T Consensus        32 PTCS~Ya~~Ai~~   44 (73)
T PRK14373         32 PTCSQYAVEAVKK   44 (73)
T ss_pred             cCHHHHHHHHHHH
Confidence            3599999999853


No 122
>PRK12528 RNA polymerase sigma factor; Provisional
Probab=21.72  E-value=1.2e+02  Score=18.90  Aligned_cols=17  Identities=24%  Similarity=0.092  Sum_probs=10.2

Q ss_pred             cCCHHHHHHhcCCCCch
Q 046034            8 SGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K   24 (64)
                      +++.++|++.||+|...
T Consensus       129 g~s~~EIA~~l~is~~t  145 (161)
T PRK12528        129 GLGYGEIATELGISLAT  145 (161)
T ss_pred             CCCHHHHHHHHCCCHHH
Confidence            45666666666666433


No 123
>PRK10840 transcriptional regulator RcsB; Provisional
Probab=21.66  E-value=1.2e+02  Score=19.63  Aligned_cols=21  Identities=29%  Similarity=0.150  Sum_probs=15.5

Q ss_pred             hcCCHHHHHHhcCCCC--chhHH
Q 046034            7 LSGLSKEIAKHLSLPP--VKLHC   27 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~--~K~HC   27 (64)
                      .+.++++|++.|++.+  .+-|-
T Consensus       164 ~G~s~~eIA~~l~iS~~TV~~h~  186 (216)
T PRK10840        164 EGFLVTEIAKKLNRSIKTISSQK  186 (216)
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHH
Confidence            4688999999998875  44443


No 124
>PF07022 Phage_CI_repr:  Bacteriophage CI repressor helix-turn-helix domain;  InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences. The CI repressor is known to function as a transcriptional switch, determining whether transcription is lytic or lysogenic [].; GO: 0003677 DNA binding, 0045892 negative regulation of transcription, DNA-dependent; PDB: 2FJR_B.
Probab=21.62  E-value=26  Score=19.71  Aligned_cols=19  Identities=26%  Similarity=0.305  Sum_probs=10.8

Q ss_pred             HHhhcCCHH-HHHHhcCCCC
Q 046034            4 LRNLSGLSK-EIAKHLSLPP   22 (64)
Q Consensus         4 ~EA~~I~~~-dI~e~LgLP~   22 (64)
                      .+++.++.+ ++++.||+++
T Consensus         7 ~~~~g~~~~~~lA~~lgis~   26 (66)
T PF07022_consen    7 KEALGVKSDKELAERLGISK   26 (66)
T ss_dssp             HHHHT-SSCHHHHCCTT--H
T ss_pred             HHHhCCCCHHHHHHHhCcCH
Confidence            456666664 8888888773


No 125
>PRK02866 cyanate hydratase; Validated
Probab=21.51  E-value=75  Score=21.50  Aligned_cols=27  Identities=19%  Similarity=0.241  Sum_probs=20.8

Q ss_pred             HhhcCCHHHHHHhcCCCCchhHHHHHH
Q 046034            5 RNLSGLSKEIAKHLSLPPVKLHCSMLA   31 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K~HCA~LA   31 (64)
                      ...++|.++|++.+|++++-..=+.++
T Consensus        15 ~~kGLTw~~IA~~iG~S~v~vaaa~lG   41 (147)
T PRK02866         15 KEKGLTWADIAEAIGLSEVWVTAALLG   41 (147)
T ss_pred             HHcCCCHHHHHHHhCCCHHHHHHHHhC
Confidence            456799999999999887766655555


No 126
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.
Probab=21.30  E-value=95  Score=14.51  Aligned_cols=20  Identities=15%  Similarity=0.219  Sum_probs=13.4

Q ss_pred             HhhcCCHHHHHHhcCCCCch
Q 046034            5 RNLSGLSKEIAKHLSLPPVK   24 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K   24 (64)
                      +...++..+++..+|+++..
T Consensus         9 ~~~~~s~~~~a~~~~~~~~~   28 (58)
T cd00093           9 KEKGLTQEELAEKLGVSRST   28 (58)
T ss_pred             HHcCCCHHHHHHHHCCCHHH
Confidence            34567777888877776543


No 127
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found in a variety of species including Rhodopirellula baltica which encodes a paralogous group of five.
Probab=21.29  E-value=65  Score=20.37  Aligned_cols=20  Identities=20%  Similarity=0.137  Sum_probs=15.6

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      -+++.++|++.||+|+.-+.
T Consensus       149 ~g~s~~EIA~~lgis~~tVk  168 (183)
T TIGR02999       149 AGLTVEEIAELLGVSVRTVE  168 (183)
T ss_pred             cCCCHHHHHHHhCCCHHHHH
Confidence            35789999999999965543


No 128
>COG3413 Predicted DNA binding protein [General function prediction only]
Probab=21.25  E-value=1.3e+02  Score=20.34  Aligned_cols=20  Identities=25%  Similarity=0.247  Sum_probs=16.4

Q ss_pred             hcCCHHHHHHhcCCCCchhH
Q 046034            7 LSGLSKEIAKHLSLPPVKLH   26 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~H   26 (64)
                      ..++-+||++.||+.+.-++
T Consensus       177 R~~~l~dLA~~lGISkst~~  196 (215)
T COG3413         177 RRVSLKDLAKELGISKSTLS  196 (215)
T ss_pred             ccCCHHHHHHHhCCCHHHHH
Confidence            46788999999999877665


No 129
>PF14813 NADH_B2:  NADH dehydrogenase 1 beta subcomplex subunit 2
Probab=21.06  E-value=45  Score=20.12  Aligned_cols=9  Identities=33%  Similarity=0.800  Sum_probs=6.4

Q ss_pred             HhcCCCCch
Q 046034           16 KHLSLPPVK   24 (64)
Q Consensus        16 e~LgLP~~K   24 (64)
                      |+||+||+.
T Consensus        61 eELGIppdd   69 (71)
T PF14813_consen   61 EELGIPPDD   69 (71)
T ss_pred             hhcCCCCCC
Confidence            567888763


No 130
>PLN03168 chalcone synthase; Provisional
Probab=21.01  E-value=84  Score=23.48  Aligned_cols=17  Identities=24%  Similarity=0.346  Sum_probs=13.2

Q ss_pred             HHHHHhcCCCCchhHHH
Q 046034           12 KEIAKHLSLPPVKLHCS   28 (64)
Q Consensus        12 ~dI~e~LgLP~~K~HCA   28 (64)
                      +.|.+.||||++|+..|
T Consensus       310 ~~v~~~Lgl~~ek~~~s  326 (389)
T PLN03168        310 DQVEAKLKLTKDKMQGS  326 (389)
T ss_pred             HHHHHHcCCCHHHHHHH
Confidence            34566679999999876


No 131
>PRK12524 RNA polymerase sigma factor; Provisional
Probab=20.96  E-value=1.7e+02  Score=19.01  Aligned_cols=32  Identities=13%  Similarity=0.046  Sum_probs=21.4

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHH
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEA   44 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~   44 (64)
                      .+++.++|++.||+|+.-+.      .-|++|....+.
T Consensus       151 ~g~s~~eIA~~lgis~~tV~------~~l~Ra~~~Lr~  182 (196)
T PRK12524        151 EGLSNPEIAEVMEIGVEAVE------SLTARGKRALAA  182 (196)
T ss_pred             cCCCHHHHHHHHCcCHHHHH------HHHHHHHHHHHH
Confidence            45788999999999875543      455555555443


No 132
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family.
Probab=20.91  E-value=2.2e+02  Score=19.84  Aligned_cols=20  Identities=20%  Similarity=0.119  Sum_probs=14.0

Q ss_pred             hhcCCHHHHHHhcCCCCchh
Q 046034            6 NLSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         6 A~~I~~~dI~e~LgLP~~K~   25 (64)
                      ..+++.++|++.||+|+.-+
T Consensus       156 ~~g~s~~EIA~~lgis~~tV  175 (324)
T TIGR02960       156 VLGWRAAETAELLGTSTASV  175 (324)
T ss_pred             HhCCCHHHHHHHHCCCHHHH
Confidence            34677788888888876543


No 133
>PRK09636 RNA polymerase sigma factor SigJ; Provisional
Probab=20.84  E-value=3e+02  Score=19.18  Aligned_cols=21  Identities=24%  Similarity=0.164  Sum_probs=15.6

Q ss_pred             HhhcCCHHHHHHhcCCCCchh
Q 046034            5 RNLSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         5 EA~~I~~~dI~e~LgLP~~K~   25 (64)
                      ...+.+.++|++.||+|+..+
T Consensus       128 ~~~g~s~~EIA~~lg~s~~tV  148 (293)
T PRK09636        128 DVFGVPFDEIASTLGRSPAAC  148 (293)
T ss_pred             HHhCCCHHHHHHHHCCCHHHH
Confidence            345778889999888886543


No 134
>PRK08301 sporulation sigma factor SigE; Reviewed
Probab=20.75  E-value=1.9e+02  Score=19.40  Aligned_cols=18  Identities=22%  Similarity=0.309  Sum_probs=13.7

Q ss_pred             cCCHHHHHHhcCCCCchh
Q 046034            8 SGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~   25 (64)
                      +++.++|++.||+|+..+
T Consensus       198 g~s~~EIA~~lgis~~tV  215 (234)
T PRK08301        198 EKTQKEVADMLGISQSYI  215 (234)
T ss_pred             CCCHHHHHHHHCCCHHHH
Confidence            567888888888886654


No 135
>PRK12539 RNA polymerase sigma factor; Provisional
Probab=20.71  E-value=2.2e+02  Score=18.21  Aligned_cols=19  Identities=11%  Similarity=-0.050  Sum_probs=13.5

Q ss_pred             hcCCHHHHHHhcCCCCchh
Q 046034            7 LSGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~   25 (64)
                      .+++.++|++.||+|...+
T Consensus       146 ~g~s~~eIA~~lgis~~tV  164 (184)
T PRK12539        146 EGLSVAEAATRSGMSESAV  164 (184)
T ss_pred             cCCcHHHHHHHHCcCHHHH
Confidence            3577788888888875543


No 136
>PRK14375 hypothetical protein; Provisional
Probab=20.54  E-value=85  Score=18.84  Aligned_cols=13  Identities=38%  Similarity=0.524  Sum_probs=10.4

Q ss_pred             hHHHHHHHHHHHH
Q 046034           25 LHCSMLAEDAIKA   37 (64)
Q Consensus        25 ~HCA~LA~~ALk~   37 (64)
                      --||.++.+|++.
T Consensus        22 PTCS~Ya~~Ai~~   34 (70)
T PRK14375         22 PTCSEYALEALKT   34 (70)
T ss_pred             cCHHHHHHHHHHH
Confidence            4599999999853


No 137
>PF08334 T2SG:  Type II secretion system (T2SS), protein G;  InterPro: IPR013545 The general secretion pathway, or type II pullulanase-like machinery, is responsible for the transport of proteins from the periplasm across the outer membrane in Gram-negative bacteria [, ]. This entry includes protein G (e.g. P45773 from SWISSPROT, Q00514 from SWISSPROT) involved in this pathway. The PulG protein (P15746 from SWISSPROT) is thought to be anchored in the inner membrane with its C terminus directed towards the periplasm []. Together with other members of the secretion machinery, it is thought to assemble into a pilus-like structure that may function as a dynamic mechanism to push secreted proteins out of the cell. The polypeptide is organised into a long N-terminal alpha-helix followed by a loop region that separates it from a C-terminal anti-parallel beta-sheet []. ; PDB: 1T92_A 3G20_B 3GN9_B 2KEP_A 3FU1_B.
Probab=20.52  E-value=1.7e+02  Score=17.57  Aligned_cols=24  Identities=17%  Similarity=0.178  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhCCCcc
Q 046034           28 SMLAEDAIKAAVKDYEAKHTKSSA   51 (64)
Q Consensus        28 A~LA~~ALk~AI~dY~~k~~~~~~   51 (64)
                      +.--...|+.||..|+.+.+.=+.
T Consensus        14 a~~~l~~i~~Ale~Y~~d~G~yP~   37 (108)
T PF08334_consen   14 AKADLRTIKTALEMYYLDNGRYPS   37 (108)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSS---
T ss_pred             HHHHHHHHHHHHHHHHHhhCCCcC
Confidence            444578899999999998877655


No 138
>COG0759 Uncharacterized conserved protein [Function unknown]
Probab=20.52  E-value=81  Score=19.97  Aligned_cols=13  Identities=38%  Similarity=0.501  Sum_probs=10.6

Q ss_pred             hHHHHHHHHHHHH
Q 046034           25 LHCSMLAEDAIKA   37 (64)
Q Consensus        25 ~HCA~LA~~ALk~   37 (64)
                      --||.+|.+||+.
T Consensus        33 PTCS~Ya~eAi~~   45 (92)
T COG0759          33 PTCSEYAIEALKK   45 (92)
T ss_pred             ccHHHHHHHHHHH
Confidence            4599999999853


No 139
>PF14698 ASL_C2:  Argininosuccinate lyase C-terminal; PDB: 1XWO_A 2E9F_A 1TJW_C 1TJU_A 1DCN_B 1K7W_B 1HY1_C 1TJV_B 1AUW_A 1U15_B ....
Probab=20.31  E-value=57  Score=18.87  Aligned_cols=18  Identities=22%  Similarity=0.399  Sum_probs=11.7

Q ss_pred             CCHHHHHHhc---CCCCchhH
Q 046034            9 GLSKEIAKHL---SLPPVKLH   26 (64)
Q Consensus         9 I~~~dI~e~L---gLP~~K~H   26 (64)
                      ++..|++++|   |+|=-.-|
T Consensus         2 ~~ATdlAD~LVr~GipFR~AH   22 (70)
T PF14698_consen    2 STATDLADYLVRKGIPFREAH   22 (70)
T ss_dssp             GGHHHHHHHHHHTTS-HHHHH
T ss_pred             ccHHHHHHHHHHcCCCHHHHH
Confidence            3567899999   89844444


No 140
>PRK12523 RNA polymerase sigma factor; Reviewed
Probab=20.30  E-value=2.4e+02  Score=17.77  Aligned_cols=18  Identities=22%  Similarity=0.224  Sum_probs=11.8

Q ss_pred             cCCHHHHHHhcCCCCchh
Q 046034            8 SGLSKEIAKHLSLPPVKL   25 (64)
Q Consensus         8 ~I~~~dI~e~LgLP~~K~   25 (64)
                      +++.++|++.||+|+.-+
T Consensus       135 g~s~~EIA~~lgis~~tV  152 (172)
T PRK12523        135 GMGHAEIAERLGVSVSRV  152 (172)
T ss_pred             CCCHHHHHHHHCCCHHHH
Confidence            466777777777775443


No 141
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=20.25  E-value=1.3e+02  Score=21.07  Aligned_cols=34  Identities=15%  Similarity=0.244  Sum_probs=22.9

Q ss_pred             HHHHHhcCCCCchhH-----HHHHHHHHHHHHHHHHHHh
Q 046034           12 KEIAKHLSLPPVKLH-----CSMLAEDAIKAAVKDYEAK   45 (64)
Q Consensus        12 ~dI~e~LgLP~~K~H-----CA~LA~~ALk~AI~dY~~k   45 (64)
                      +.|.+.||||++|+.     +-+++--.+=-++.++..+
T Consensus       273 ~~~~~~lgl~~~k~~~~~~~~GN~~sas~~~~L~~~~~~  311 (338)
T PRK09258        273 RAILKALGIDPEKVFTTFPTLGNMGPASLPITLAMAAEE  311 (338)
T ss_pred             HHHHHHhCCCHHHceehHhhhCCcHHhHHHHHHHHHHHh
Confidence            457777899999987     5555555555666666544


No 142
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional
Probab=20.23  E-value=2e+02  Score=18.34  Aligned_cols=29  Identities=14%  Similarity=0.203  Sum_probs=20.3

Q ss_pred             hcCCHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHh
Q 046034            7 LSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAK   45 (64)
Q Consensus         7 ~~I~~~dI~e~LgLP~~K~HCA~LA~~ALk~AI~dY~~k   45 (64)
                      ..++.++|+++||+.+          .++.+.+++.+.+
T Consensus       167 ~~~t~~~lA~~lG~tr----------~tvsR~l~~l~~~  195 (211)
T PRK11753        167 IKITRQEIGRIVGCSR----------EMVGRVLKMLEDQ  195 (211)
T ss_pred             cCCCHHHHHHHhCCCH----------HHHHHHHHHHHHC
Confidence            3688899999999884          4455566655544


No 143
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. Helix-turn-helix (HTH) transcription regulator MerR superfamily, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=20.11  E-value=73  Score=15.92  Aligned_cols=13  Identities=31%  Similarity=0.381  Sum_probs=7.1

Q ss_pred             CHHHHHHhcCCCC
Q 046034           10 LSKEIAKHLSLPP   22 (64)
Q Consensus        10 ~~~dI~e~LgLP~   22 (64)
                      +-.++++.||+++
T Consensus         2 ~~~e~a~~~gv~~   14 (49)
T cd04761           2 TIGELAKLTGVSP   14 (49)
T ss_pred             cHHHHHHHHCcCH
Confidence            3455666566663


No 144
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.
Probab=20.09  E-value=77  Score=15.30  Aligned_cols=11  Identities=36%  Similarity=0.480  Sum_probs=5.6

Q ss_pred             HHHHHHhcCCC
Q 046034           11 SKEIAKHLSLP   21 (64)
Q Consensus        11 ~~dI~e~LgLP   21 (64)
                      -.++++.||++
T Consensus         3 ~~e~a~~lgvs   13 (49)
T cd04762           3 TKEAAELLGVS   13 (49)
T ss_pred             HHHHHHHHCcC
Confidence            34555555554


Done!