Citrus Sinensis ID: 046034


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60----
MANLRNLSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKHTKSSAASEAAPAEKAADA
cccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccc
*****N**GLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKD***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLRNLSGLSKEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKHTKSSAASEAAPAEKAADA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Iron-sulfur cluster assembly enzyme ISCU, mitochondrial Involved in the assembly or repair of [Fe-S] clusters that are present in iron-sulfur proteins. Binds iron.probableQ9D7P6
Iron sulfur cluster assembly protein 1, mitochondrial Involved in iron homeostasis within the mitochondrion where it is involved in the assembly of iron-sulfur proteins. Essential for de novo biosynthesis of mitochondrial and cytoplasmic iron sulfur proteins. May also be involved in the repair of iron sulfur clusters.probableQ9UTC6
Iron sulfur cluster assembly protein 1, mitochondrial Involved in iron homeostasis within the mitochondrion where it is involved in the assembly of iron-sulfur proteins. Essential for de novo biosynthesis of mitochondrial and cytoplasmic iron sulfur proteins. May also be involved in the repair of iron sulfur clusters.probableQ6CRQ9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVL, chain A
Confidence level:very confident
Coverage over the Query: 2-47
View the alignment between query and template
View the model in PyMOL