Query         046038
Match_columns 265
No_of_seqs    127 out of 1122
Neff          8.0 
Searched_HMMs 13730
Date          Mon Mar 25 14:02:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046038.a3m -d /work/01045/syshi/HHdatabase/scop70.hhm -o /work/01045/syshi/hhsearch_scop/046038hhsearch_scop -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1v54d_ f.23.1.1 (D:) Mitochon  10.4 1.6E+02   0.012   20.5   4.4   30   48-80     65-94  (144)
  2 d1rh5b_ f.23.28.1 (B:) Preprot   7.1 2.3E+02   0.017   16.3   3.6   31   50-86     14-44  (56)
  3 d2pila_ d.24.1.1 (A:) Pilin Gc   5.5 1.7E+02   0.012   19.1   2.6   18  175-192    10-27  (158)
  4 d1q90r_ f.23.12.1 (R:) ISP sub   5.0 2.7E+02    0.02   14.8   2.5   18  196-213    18-35  (39)
  5 d1ciya3 f.1.3.1 (A:33-255) del   4.5 2.8E+02    0.02   20.3   3.4   27  174-200     7-33  (223)
  6 d1v54j_ f.23.4.1 (J:) Mitochon   3.8 4.2E+02    0.03   15.2   3.0   20  236-255    35-54  (58)
  7 d2e74d2 f.23.12.1 (D:12-45) IS   3.0 3.8E+02   0.028   13.3   2.4   18  197-214    14-31  (34)
  8 d3cx5c1 f.32.1.1 (C:262-385) M   2.9 6.1E+02   0.044   16.5   3.6   15  186-200    24-39  (124)
  9 d1ppjc1 f.32.1.1 (C:261-379) M   2.7 6.2E+02   0.045   16.4   3.5   15  186-200    24-39  (119)
 10 d1dlca3 f.1.3.1 (A:61-289) del   2.5 4.1E+02    0.03   19.4   2.4   27  180-210    16-42  (229)

No 1  
>d1v54d_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
Probab=10.36  E-value=1.6e+02  Score=20.52  Aligned_cols=30  Identities=10%  Similarity=-0.074  Sum_probs=18.0

Q ss_pred             hhhhcCCccchhhhhHHHHHHHHHHHHHHHhhh
Q 046038           48 QDTLRSSPPENKVMKRASFVGVSITTIFYMLCG   80 (265)
Q Consensus        48 ~~~mk~P~~~~~~~~~vl~~a~~i~~~~y~~~g   80 (265)
                      +.||+.|+   ..++.++..++..+.+-..++.
T Consensus        65 ~ae~~~p~---gewK~v~g~~~~~i~~s~~i~~   94 (144)
T d1v54d_          65 FAEMNRST---NEWKTVVGAAMFFIGFTALLLI   94 (144)
T ss_dssp             HHHHTCCC---SHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccCCC---CchhHHHHHHHHHHHHHHHHHH
Confidence            47898885   4677777665544444333333


No 2  
>d1rh5b_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=7.15  E-value=2.3e+02  Score=16.31  Aligned_cols=31  Identities=19%  Similarity=0.309  Sum_probs=17.1

Q ss_pred             hhcCCccchhhhhHHHHHHHHHHHHHHHhhhhhhhhc
Q 046038           50 TLRSSPPENKVMKRASFVGVSITTIFYMLCGTLGYAA   86 (265)
Q Consensus        50 ~mk~P~~~~~~~~~vl~~a~~i~~~~y~~~g~~GY~~   86 (265)
                      --++|  +++.|.++...+ .+.   ..++|+.||.-
T Consensus        14 ~~~KP--~~~Ef~~ia~v~-~iG---~~i~G~IGf~I   44 (56)
T d1rh5b_          14 VLKKP--TKDEYLAVAKVT-ALG---ISLLGIIGYII   44 (56)
T ss_dssp             SEECC--CHHHHHHHHHHH-HHH---HHHHHHHHHHH
T ss_pred             HhcCC--CHHHHHHHHHHH-HHH---HHHHHHHHHHH
Confidence            34677  557788866553 222   34455566543


No 3  
>d2pila_ d.24.1.1 (A:) Pilin Gc {Neisseria gonorrhoeae [TaxId: 485]}
Probab=5.54  E-value=1.7e+02  Score=19.08  Aligned_cols=18  Identities=17%  Similarity=0.364  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHhcCchHHH
Q 046038          175 YVILTAVIAMLFPFFNSV  192 (265)
Q Consensus       175 ~v~~~~~iAi~iP~~~~v  192 (265)
                      +.++..+.|+.+|.+...
T Consensus        10 iaIIgILaaia~P~~~~~   27 (158)
T d2pila_          10 IAIVGILAAVALPAYQDY   27 (158)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344555556666665443


No 4  
>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]}
Probab=4.99  E-value=2.7e+02  Score=14.77  Aligned_cols=18  Identities=11%  Similarity=0.071  Sum_probs=9.4

Q ss_pred             hhhhhhhhHHHHHHHHHH
Q 046038          196 LGAIAFWPLTVYFPVEMY  213 (265)
Q Consensus       196 vGs~~~~~l~filP~l~y  213 (265)
                      +|+.+........|-.-|
T Consensus        18 ~G~~~~~~~g~l~py~~f   35 (39)
T d1q90r_          18 AGGAGLPITTLALGYGAF   35 (39)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HhccchhhhhhccceeEE
Confidence            355555555555554433


No 5  
>d1ciya3 f.1.3.1 (A:33-255) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}
Probab=4.51  E-value=2.8e+02  Score=20.29  Aligned_cols=27  Identities=19%  Similarity=0.236  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHhcCchHHHHHHhhhhh
Q 046038          174 VYVILTAVIAMLFPFFNSVIGLLGAIA  200 (265)
Q Consensus       174 ~~v~~~~~iAi~iP~~~~vlslvGs~~  200 (265)
                      .+-++.++++.++|..|.++++++-+-
T Consensus         7 ~~~~~~~ll~~~iP~~g~~~~li~~lw   33 (223)
T d1ciya3           7 SLSLTQFLLSEFVPGAGFVLGLVDIIW   33 (223)
T ss_dssp             HHHHHHHHHHCCSSSHHHHHHHHHHTT
T ss_pred             HHHHHHHHhhhcCCchHHHHHHHHHHc
Confidence            344677888888999998887765553


No 6  
>d1v54j_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
Probab=3.77  E-value=4.2e+02  Score=15.22  Aligned_cols=20  Identities=15%  Similarity=-0.107  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhc
Q 046038          236 CFIVTLLAAAGSIQGLVKDL  255 (265)
Q Consensus       236 g~~~~v~Gty~si~~ii~~~  255 (265)
                      -..++++|+..|+..+....
T Consensus        35 Tm~L~~~G~~~s~~~l~~a~   54 (58)
T d1v54j_          35 TMTLCLGGTLYSLYCLGWAS   54 (58)
T ss_dssp             HHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            33456778888888776543


No 7  
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
Probab=2.97  E-value=3.8e+02  Score=13.34  Aligned_cols=18  Identities=22%  Similarity=0.490  Sum_probs=13.4

Q ss_pred             hhhhhhhHHHHHHHHHHH
Q 046038          197 GAIAFWPLTVYFPVEMYI  214 (265)
Q Consensus       197 Gs~~~~~l~filP~l~yl  214 (265)
                      |+.+++.+.-..|..=|.
T Consensus        14 gt~tg~alg~lypvvkyf   31 (34)
T d2e74d2          14 GTVTGVALGALYPLVKYF   31 (34)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHhhhhhHHhhc
Confidence            777788888888876554


No 8  
>d3cx5c1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=2.88  E-value=6.1e+02  Score=16.53  Aligned_cols=15  Identities=33%  Similarity=0.452  Sum_probs=8.2

Q ss_pred             cCc-hHHHHHHhhhhh
Q 046038          186 FPF-FNSVIGLLGAIA  200 (265)
Q Consensus       186 iP~-~~~vlslvGs~~  200 (265)
                      +|+ ++-++.+++|+.
T Consensus        24 iP~k~~Gvl~~~~si~   39 (124)
T d3cx5c1          24 IPDKLLGVITMFAAIL   39 (124)
T ss_dssp             SSSHHHHHHHHHHHHH
T ss_pred             CCcchhhhHHHHHHHH
Confidence            674 555555555543


No 9  
>d1ppjc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
Probab=2.71  E-value=6.2e+02  Score=16.42  Aligned_cols=15  Identities=27%  Similarity=0.368  Sum_probs=9.0

Q ss_pred             cCc-hHHHHHHhhhhh
Q 046038          186 FPF-FNSVIGLLGAIA  200 (265)
Q Consensus       186 iP~-~~~vlslvGs~~  200 (265)
                      +|+ ++-++.+++|+.
T Consensus        24 ipnK~gGvl~m~~si~   39 (119)
T d1ppjc1          24 IPNKLGGVLALAFSIL   39 (119)
T ss_dssp             CSSHHHHHHHHHHHHH
T ss_pred             CCchhHHHHHHHHHHH
Confidence            774 666666665553


No 10 
>d1dlca3 f.1.3.1 (A:61-289) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId: 1444]}
Probab=2.47  E-value=4.1e+02  Score=19.35  Aligned_cols=27  Identities=19%  Similarity=0.299  Sum_probs=16.1

Q ss_pred             HHHHHhcCchHHHHHHhhhhhhhhHHHHHHH
Q 046038          180 AVIAMLFPFFNSVIGLLGAIAFWPLTVYFPV  210 (265)
Q Consensus       180 ~~iAi~iP~~~~vlslvGs~~~~~l~filP~  210 (265)
                      .+-++.+|..+.++++++    ..+.++.|.
T Consensus        16 il~~~~~P~~g~~~~~~~----~i~~~lwP~   42 (229)
T d1dlca3          16 LLGVVGFPFGGALVSFYT----NFLNTIWPS   42 (229)
T ss_dssp             HTTSCBSCCHHHHHHHHH----HHHHHTSSS
T ss_pred             HHHhcCCCcHHHHHHHHH----HHHHHhCCC
Confidence            333345788887776654    345555664


Done!