BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046046
         (177 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MVP|A Chain A, The Crystal Structure Of A TetrACRR TRANSCRIPTIONAL
           REGULAT Streptococcus Mutans To 1.85a
 pdb|3MVP|B Chain B, The Crystal Structure Of A TetrACRR TRANSCRIPTIONAL
           REGULAT Streptococcus Mutans To 1.85a
          Length = 217

 Score = 26.9 bits (58), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 48  QLVVSLDKMFWSKPASLALAPDSPLRVDEPKYEGIKHFILKLMLFYSKQS 97
           QL+ + DK+F ++   LA A      + E     +K+   K +L+YS Q+
Sbjct: 116 QLLAAEDKIFHAQIEXLAYAIPQAKALLEEHNNNLKNLTYKCLLYYSDQA 165


>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex
 pdb|4B8C|J Chain J, Nuclease Module Of The Yeast Ccr4-Not Complex
 pdb|4B8C|K Chain K, Nuclease Module Of The Yeast Ccr4-Not Complex
 pdb|4B8C|L Chain L, Nuclease Module Of The Yeast Ccr4-Not Complex
          Length = 727

 Score = 26.9 bits (58), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 74  VDEPKYEGIKHFILKLMLFYSKQSKSIRGANVIYKR 109
           +D+  Y GI H   +    +SK SK + G  + +KR
Sbjct: 460 LDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKR 495


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,862,969
Number of Sequences: 62578
Number of extensions: 109490
Number of successful extensions: 265
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 263
Number of HSP's gapped (non-prelim): 3
length of query: 177
length of database: 14,973,337
effective HSP length: 92
effective length of query: 85
effective length of database: 9,216,161
effective search space: 783373685
effective search space used: 783373685
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)