BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046046
(177 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MVP|A Chain A, The Crystal Structure Of A TetrACRR TRANSCRIPTIONAL
REGULAT Streptococcus Mutans To 1.85a
pdb|3MVP|B Chain B, The Crystal Structure Of A TetrACRR TRANSCRIPTIONAL
REGULAT Streptococcus Mutans To 1.85a
Length = 217
Score = 26.9 bits (58), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 15/50 (30%), Positives = 26/50 (52%)
Query: 48 QLVVSLDKMFWSKPASLALAPDSPLRVDEPKYEGIKHFILKLMLFYSKQS 97
QL+ + DK+F ++ LA A + E +K+ K +L+YS Q+
Sbjct: 116 QLLAAEDKIFHAQIEXLAYAIPQAKALLEEHNNNLKNLTYKCLLYYSDQA 165
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex
pdb|4B8C|J Chain J, Nuclease Module Of The Yeast Ccr4-Not Complex
pdb|4B8C|K Chain K, Nuclease Module Of The Yeast Ccr4-Not Complex
pdb|4B8C|L Chain L, Nuclease Module Of The Yeast Ccr4-Not Complex
Length = 727
Score = 26.9 bits (58), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 12/36 (33%), Positives = 19/36 (52%)
Query: 74 VDEPKYEGIKHFILKLMLFYSKQSKSIRGANVIYKR 109
+D+ Y GI H + +SK SK + G + +KR
Sbjct: 460 LDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKR 495
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.137 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,862,969
Number of Sequences: 62578
Number of extensions: 109490
Number of successful extensions: 265
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 263
Number of HSP's gapped (non-prelim): 3
length of query: 177
length of database: 14,973,337
effective HSP length: 92
effective length of query: 85
effective length of database: 9,216,161
effective search space: 783373685
effective search space used: 783373685
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)