BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046142
         (132 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3BBO|I Chain I, Homology Model For The Spinach Chloroplast 50s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
          Length = 223

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 65/110 (59%), Gaps = 5/110 (4%)

Query: 16  NHMSNLCDKFT---LTWMEAKFLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPS 72
           N M  L    T   +  +   F + L +VGVGY  RA  +G+ L L LG+ H V++ +P 
Sbjct: 105 NQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGY--RATVDGKELVLNLGFSHPVKMQIPD 162

Query: 73  AVRIFCLKNNVVCCCGLDKHRVHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           ++++   +N  +   G DK  + QFAA+VR  +PP+P+KGKG+  +DE++
Sbjct: 163 SLKVKVEENTRITVSGYDKSEIGQFAATVRKWRPPEPYKGKGVKYSDEIV 212


>pdb|1RL6|A Chain A, Ribosomal Protein L6
 pdb|1C04|B Chain B, Identification Of Known Protein And Rna Structures In A 5
           A Map Of The Large Ribosomal Subunit From Haloarcula
           Marismortui
 pdb|1GIY|H Chain H, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1giy, Contains The 50s Ribosome Subunit. The
           30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
           In The File 1gix
 pdb|1ML5|HH Chain h, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 pdb|1YL3|H Chain H, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 pdb|2B66|H Chain H, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 pdb|2B9N|H Chain H, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 pdb|2B9P|H Chain H, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400
          Length = 177

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L++VGVGY  RA  +G+ L L +GY H VE+     + I       +   G DK R
Sbjct: 82  YEKALELVGVGY--RASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQR 139

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V + AA++R+ +PP+P+KGKGI    E++
Sbjct: 140 VGELAANIRAVRPPEPYKGKGIRYEGELV 168


>pdb|1EG0|J Chain J, Fitting Of Components With Known Structure Into An 11.5 A
           Cryo-Em Map Of The E.Coli 70s Ribosome
          Length = 171

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L++VGVGY  RA  +G+ L L +GY H VE+     + I       +   G DK R
Sbjct: 83  YEKALELVGVGY--RASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQR 140

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V + AA++R+ +PP+P+KGKGI    E++
Sbjct: 141 VGELAANIRAVRPPEPYKGKGIRYEGELV 169


>pdb|487D|J Chain J, Seven Ribosomal Proteins Fitted To A Cryo-Electron
           Microscopic Map Of The Large 50s Subunit At 7.5
           Angstroms Resolution
          Length = 164

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L++VGVGY  RA  +G+ L L +GY H VE+     + I       +   G DK R
Sbjct: 76  YEKALELVGVGY--RASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQR 133

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V + AA++R+ +PP+P+KGKGI    E++
Sbjct: 134 VGELAANIRAVRPPEPYKGKGIRYEGELV 162


>pdb|1VS6|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS8|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|3E1B|3 Chain 3, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Pre-Accommodation State
 pdb|3E1D|3 Chain 3, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Post-Accommodation State
 pdb|3I1N|G Chain G, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1P|G Chain G, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1R|G Chain G, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1T|G Chain G, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I20|G Chain G, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I22|G Chain G, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KCR|G Chain G, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 pdb|1VT2|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3ORB|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 pdb|3IZT|H Chain H, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 pdb|3IZU|H Chain H, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 pdb|3SGF|G Chain G, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome
 pdb|3UOS|G Chain G, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome (Without
           Viomycin)
 pdb|4GAR|G Chain G, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAU|G Chain G, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 177

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           F + L++VGVGY  RA  +G ++ L LG+ H V+  +P+ +   C     +   G DK  
Sbjct: 83  FTKKLQLVGVGY--RAAVKGNVINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQV 140

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           + Q AA +R+ + P+P+KGKG+  ADEV+
Sbjct: 141 IGQVAADLRAYRRPEPYKGKGVRYADEVV 169


>pdb|1P85|E Chain E, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P86|E Chain E, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AWB|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|2I2T|G Chain G, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2V|G Chain G, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2J28|G Chain G, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|2QOV|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
           The Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QOX|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QOZ|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAO|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBA|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBC|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBE|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBG|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBI|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The First 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBK|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The Second 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The First 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The Second 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2VHM|G Chain G, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 1 Of 4)
 pdb|2VHN|G Chain G, Structure Of Pdf Binding Helix In Complex With The
           Ribosome. (Part 2 Of 4)
 pdb|2RDO|G Chain G, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|3DF2|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The First 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3DF4|G Chain G, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The Second 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3BBX|G Chain G, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
           Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3FIK|G Chain G, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 50s Subunit.
 pdb|2WWQ|G Chain G, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 50s, The P-Site
           Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|3OFQ|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFR|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFZ|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAS|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAT|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Telithromycin Bound.
 pdb|3J01|G Chain G, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|3R8S|G Chain G, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3R8T|G Chain G, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3J0T|H Chain H, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0W|H Chain H, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0Y|H Chain H, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J11|H Chain H, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 3 Of The Six
           Classes)
 pdb|3J12|H Chain H, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J14|H Chain H, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J19|G Chain G, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (50s Subunit)
          Length = 176

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           F + L++VGVGY  RA  +G ++ L LG+ H V+  +P+ +   C     +   G DK  
Sbjct: 82  FTKKLQLVGVGY--RAAVKGNVINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQV 139

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           + Q AA +R+ + P+P+KGKG+  ADEV+
Sbjct: 140 IGQVAADLRAYRRPEPYKGKGVRYADEVV 168


>pdb|2GYA|E Chain E, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYC|E Chain E, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 167

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           F + L++VGVGY  RA  +G ++ L LG+ H V+  +P+ +   C     +   G DK  
Sbjct: 78  FTKKLQLVGVGY--RAAVKGNVINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQV 135

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           + Q AA +R+ + P+P+KGKG+  ADEV+
Sbjct: 136 IGQVAADLRAYRRPEPYKGKGVRYADEVV 164


>pdb|1PNU|E Chain E, Crystal Structure Of A Streptomycin Dependent Ribosome
           From Escherichia Coli, 50s Subunit Of 70s Ribosome. This
           File, 1pnu, Contains Only Molecules Of The 50s Ribosomal
           Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site
           Trna Are In The Pdb File 1pns.
 pdb|1PNY|E Chain E, Crystal Structure Of The Wild Type Ribosome From E. Coli,
           50s Subunit Of 70s Ribosome. This File, 1pny, Contains
           Only Molecules Of The 50s Ribosomal Subunit. The 30s
           Subunit Is In The Pdb File 1pnx.
 pdb|1VOR|H Chain H, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOU|H Chain H, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOW|H Chain H, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOY|H Chain H, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VP0|H Chain H, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400
          Length = 177

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 16  NHMSNLCDKFTLTWMEAKFLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVR 75
           N +  + D +T+          L++ GVG+  RA+  G+ L + +GY H V +  P+ V 
Sbjct: 70  NAVKGVSDGYTIN---------LELRGVGF--RAKLTGKALEMNIGYSHPVIIEPPAGVT 118

Query: 76  IFCLKNNVVCCCGLDKHRVHQFAASVRSRKPPDPFKGKGIMCADEVI 122
               +   +   G+DK  V Q AA+VR  + PD + GKG+    E I
Sbjct: 119 FAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQI 165


>pdb|1NWX|E Chain E, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Abt-773
 pdb|1NWY|E Chain E, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Azithromycin
 pdb|1XBP|E Chain E, Inhibition Of Peptide Bond Formation By Pleuromutilins:
           The Structure Of The 50s Ribosomal Subunit From
           Deinococcus Radiodurans In Complex With Tiamulin
 pdb|2ZJP|E Chain E, Thiopeptide Antibiotic Nosiheptide Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 pdb|2ZJQ|E Chain E, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 pdb|2ZJR|E Chain E, Refined Native Structure Of The Large Ribosomal Subunit
           (50s) From Deinococcus Radiodurans
 pdb|3CF5|E Chain E, Thiopeptide Antibiotic Thiostrepton Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 pdb|3DLL|E Chain E, The Oxazolidinone Antibiotics Perturb The Ribosomal
           Peptidyl-Transferase Center And Effect Trna Positioning
 pdb|3PIO|E Chain E, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 pdb|3PIP|E Chain E, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
          Length = 185

 Score = 55.5 bits (132), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 16  NHMSNLCDKFTLTWMEAKFLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVR 75
           N +  + D +T+          L++ GVG+  RA+  G+ L + +GY H V +  P+ V 
Sbjct: 74  NAVKGVSDGYTIN---------LELRGVGF--RAKLTGKALEMNIGYSHPVIIEPPAGVT 122

Query: 76  IFCLKNNVVCCCGLDKHRVHQFAASVRSRKPPDPFKGKGIMCADEVI 122
               +   +   G+DK  V Q AA+VR  + PD + GKG+    E I
Sbjct: 123 FAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQI 169


>pdb|1NKW|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From
           Deinococcus Radiodurans
 pdb|1SM1|E Chain E, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Quinupristin And Dalfopristin
          Length = 212

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 16  NHMSNLCDKFTLTWMEAKFLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVR 75
           N +  + D +T+          L++ GVG+  RA+  G+ L + +GY H V +  P+ V 
Sbjct: 101 NAVKGVSDGYTIN---------LELRGVGF--RAKLTGKALEMNIGYSHPVIIEPPAGVT 149

Query: 76  IFCLKNNVVCCCGLDKHRVHQFAASVRSRKPPDPFKGKGIMCADEVI 122
               +   +   G+DK  V Q AA+VR  + PD + GKG+    E I
Sbjct: 150 FAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQI 196


>pdb|3FIN|H Chain H, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 50s Subunit
          Length = 160

 Score = 52.0 bits (123), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L I G+GY+AR    GR L L +G+ H V +  P  +     +   V   G+DK +
Sbjct: 72  YSKELLIKGIGYRARLV--GRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQK 129

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V Q AA++R+ + P  +  KGI  A E +
Sbjct: 130 VGQVAANIRAIRKPSAYHEKGIYYAGEPV 158


>pdb|3PYO|G Chain G, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYR|G Chain G, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome.
 pdb|3PYT|G Chain G, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYV|G Chain G, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The Second 70s Ribosome
          Length = 159

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L I G+GY+AR    GR L L +G+ H V +  P  +     +   V   G+DK +
Sbjct: 72  YSKELLIKGIGYRARLV--GRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQK 129

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V Q AA++R+ + P  +  KGI  A E +
Sbjct: 130 VGQVAANIRAIRKPSAYHEKGIYYAGEPV 158


>pdb|2J01|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 pdb|2J03|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 pdb|2HGJ|H Chain H, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 pdb|2HGQ|H Chain H, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 pdb|2HGU|H Chain H, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr.
 pdb|1VSA|F Chain F, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
           Subunit Is In The File 2ow8
 pdb|2V47|H Chain H, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 pdb|2V49|H Chain H, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 pdb|1VSP|F Chain F, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 1vsp, Contains The 50s
           Ribosome Subunit. 30s Ribosome Subunit Is In The File
           2qnh
 pdb|3D5B|H Chain H, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 pdb|3D5D|H Chain H, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 pdb|3F1F|H Chain H, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes As Described In
           Remark 400.
 pdb|3F1H|H Chain H, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes As
           Described In Remark 400.
 pdb|2WDI|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 pdb|2WDJ|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WDL|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 pdb|2WDN|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 pdb|2WH2|H Chain H, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|2WH4|H Chain H, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|3HUX|H Chain H, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 pdb|3HUZ|H Chain H, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WRJ|H Chain H, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 2 Of 4).
 pdb|2WRL|H Chain H, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State. (Part 4 Of
           4).
 pdb|2WRO|H Chain H, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 2 Of 4).
 pdb|2WRR|H Chain H, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 4 Of 4).
 pdb|3KIR|H Chain H, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 pdb|3KIT|H Chain H, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 pdb|3KIW|H Chain H, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 pdb|3KIY|H Chain H, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 pdb|3KNI|H Chain H, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 pdb|3KNK|H Chain H, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 pdb|3KNM|H Chain H, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 pdb|3KNO|H Chain H, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 pdb|3I8F|H Chain H, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 pdb|3I8I|H Chain H, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 pdb|3I9C|H Chain H, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 pdb|3I9E|H Chain H, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 pdb|2X9S|H Chain H, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2X9U|H Chain H, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|3MRZ|G Chain G, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (50s) And 3ms1 (30s).
 pdb|3MS1|G Chain G, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 pdb|2XG0|H Chain H, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 pdb|2XG2|H Chain H, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 pdb|3OH5|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OH7|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OHJ|H Chain H, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHK|H Chain H, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHZ|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI1|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI3|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI5|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2XQE|H Chain H, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 pdb|2XTG|H Chain H, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 pdb|2XUX|H Chain H, Trna Translocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 pdb|2Y0V|H Chain H, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0X|H Chain H, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0Z|H Chain H, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y11|H Chain H, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|2Y13|H Chain H, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y15|H Chain H, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 pdb|2Y17|H Chain H, Ef-Tu Complex 3
 pdb|2Y19|H Chain H, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|3ZVP|H Chain H, Crystal Structure Of The Hybrid State Of Ribosome In
           Complex With The Guanosine Triphosphatase Release Factor
           3
 pdb|3UXQ|H Chain H, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UXR|H Chain H, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UYE|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UYG|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UZ1|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin
 pdb|3UZ2|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin.
 pdb|3UZ8|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZ9|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZF|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex
 pdb|3UZH|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex.
 pdb|3UZK|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex With Paromomycin
 pdb|3UZN|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-cognate
           Trna-tyr Complex With Paromomycin
 pdb|4ABS|H Chain H, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin
           With The 70s Ribosome
 pdb|4DHA|H Chain H, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHC|H Chain H, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V23|H Chain H, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V25|H Chain H, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|3V27|H Chain H, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V29|H Chain H, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Entry Contains The 50s Subunit Of The 2nd Molecule In
           The Asu.
 pdb|3V2D|H Chain H, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V2F|H Chain H, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|4G5L|H Chain H, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5N|H Chain H, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule B.
 pdb|4G5U|H Chain H, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5W|H Chain H, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule B
          Length = 180

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L I G+GY+AR    GR L L +G+ H V +  P  +     +   V   G+DK +
Sbjct: 83  YSKELLIKGIGYRARLV--GRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQK 140

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V Q AA++R+ + P  +  KGI  A E +
Sbjct: 141 VGQVAANIRAIRKPSAYHEKGIYYAGEPV 169


>pdb|3TVE|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
 pdb|3TVH|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
          Length = 170

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 34  FLRFLKIVGVGYKARAEAEGRLLYLKLGYVHDVELTVPSAVRIFCLKNNVVCCCGLDKHR 93
           + + L I G+GY+AR    GR L L +G+ H V +  P  +     +   V   G+DK +
Sbjct: 82  YSKELLIKGIGYRARLV--GRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQK 139

Query: 94  VHQFAASVRSRKPPDPFKGKGIMCADEVI 122
           V Q AA++R+ + P  +  KGI  A E +
Sbjct: 140 VGQVAANIRAIRKPSAYHEKGIYYAGEPV 168


>pdb|3HWK|A Chain A, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|B Chain B, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|C Chain C, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|D Chain D, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|E Chain E, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|F Chain F, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|G Chain G, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
 pdb|3HWK|H Chain H, Crystal Structure Of Methylcitrate Synthase From
           Mycobacterium Tuberculosis
          Length = 414

 Score = 25.4 bits (54), Expect = 8.2,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 11  NEDALNHMSNLCDKFTL-TWMEAKFLRFLKIVGVGYKARAEAEGRLLYLK 59
           NE  ++ M  + D      W+ AK  R  KI+G G++     + R+  +K
Sbjct: 267 NEAVMHDMIEIGDPANAREWLRAKLARKEKIMGFGHRVYRHGDSRVPTMK 316


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,676,229
Number of Sequences: 62578
Number of extensions: 129671
Number of successful extensions: 273
Number of sequences better than 100.0: 15
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 252
Number of HSP's gapped (non-prelim): 15
length of query: 132
length of database: 14,973,337
effective HSP length: 88
effective length of query: 44
effective length of database: 9,466,473
effective search space: 416524812
effective search space used: 416524812
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 46 (22.3 bits)