Query 046153
Match_columns 81
No_of_seqs 102 out of 206
Neff 4.1
Searched_HMMs 46136
Date Fri Mar 29 09:13:06 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046153.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046153hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF01439 Metallothio_2: Metall 100.0 2.1E-34 4.5E-39 185.3 5.4 67 1-78 1-69 (74)
2 PF01439 Metallothio_2: Metall 92.4 0.078 1.7E-06 34.3 1.5 14 11-24 2-15 (74)
3 KOG4738 Predicted metallothion 91.4 0.22 4.8E-06 30.3 2.5 25 8-32 7-32 (51)
4 PF02067 Metallothio_5: Metall 85.3 0.51 1.1E-05 27.6 1.2 14 8-21 17-30 (41)
5 PF05522 Metallothio_6: Metall 84.8 0.46 1E-05 30.2 1.0 19 9-28 41-59 (65)
6 PF03940 MSSP: Male specific s 34.5 45 0.00098 19.9 2.3 19 10-28 8-26 (48)
7 TIGR03601 B_an_ocin probable h 27.8 60 0.0013 21.2 2.2 21 7-27 44-65 (79)
8 PF02068 Metallothio_PEC: Plan 24.3 56 0.0012 21.3 1.6 22 8-30 2-23 (76)
9 PF15193 FAM24: FAM24 family 22.9 32 0.00069 22.1 0.3 12 23-34 45-56 (69)
10 PF09791 Oxidored-like: Oxidor 21.2 44 0.00095 19.7 0.6 8 20-27 19-26 (48)
11 PF01754 zf-A20: A20-like zinc 21.1 45 0.00097 17.3 0.6 11 71-81 3-13 (25)
No 1
>PF01439 Metallothio_2: Metallothionein; InterPro: IPR000347 Members of this family are metallothioneins. These proteins are cysteine rich proteins that bind to heavy metals. Members of this family appear to be closest to Class II metallothioneins.; GO: 0046872 metal ion binding
Probab=100.00 E-value=2.1e-34 Score=185.34 Aligned_cols=67 Identities=60% Similarity=1.065 Sum_probs=61.3
Q ss_pred CCc-cCCCCCCCccCCCCCCcCCCCCCCCcCCCCCCCcCCCcccceEEEeecCCccchhhhhcccC-CCCCCCCCCCCcc
Q 046153 1 MSC-CGRNCGRNCGCGSSCKCGSDYNVCRMYPDLSYSENPTTTIDILVLGDAYAKMNYEVSEMGFG-AEGDCKCKFYKNF 78 (81)
Q Consensus 1 MSc-cg~~~~gnCgCGs~C~CGsgC~gCkMyPDl~~~E~ttt~~~tlVlGVAP~K~~~egse~~~~-~e~GCKCGsnc~~ 78 (81)
||| || +||+|||+|+||+ ||||||+|+|++|| +||||||||+|.+||++||+++ +++|||||+||+=
T Consensus 1 MsC~Cg----gnCgCGs~C~Cg~-----kmypdl~~~~~ttt--~t~V~GVAP~k~~~eg~E~~~~~~~~GCKCGsnC~C 69 (74)
T PF01439_consen 1 MSCGCG----GNCGCGSGCKCGS-----KMYPDLEESETTTT--ETLVLGVAPQKGHFEGSEMGAGAGGNGCKCGSNCTC 69 (74)
T ss_pred CCCcCC----CcCCCCCCCCcCC-----ccccchhccccccc--eeEEEeeCCCcchhhhhhhhhcccCCCCCCCCCCcc
Confidence 899 99 9999999999998 99999998887766 9999999999999999999877 5579999999973
No 2
>PF01439 Metallothio_2: Metallothionein; InterPro: IPR000347 Members of this family are metallothioneins. These proteins are cysteine rich proteins that bind to heavy metals. Members of this family appear to be closest to Class II metallothioneins.; GO: 0046872 metal ion binding
Probab=92.44 E-value=0.078 Score=34.28 Aligned_cols=14 Identities=57% Similarity=1.633 Sum_probs=13.0
Q ss_pred CccCCCCCCcCCCC
Q 046153 11 NCGCGSSCKCGSDY 24 (81)
Q Consensus 11 nCgCGs~C~CGsgC 24 (81)
+|+||++|+|||+|
T Consensus 2 sC~CggnCgCGs~C 15 (74)
T PF01439_consen 2 SCGCGGNCGCGSGC 15 (74)
T ss_pred CCcCCCcCCCCCCC
Confidence 58999999999998
No 3
>KOG4738 consensus Predicted metallothionein [Inorganic ion transport and metabolism]
Probab=91.36 E-value=0.22 Score=30.28 Aligned_cols=25 Identities=40% Similarity=0.854 Sum_probs=19.8
Q ss_pred CCCCccCCCCCCcCCC-CCCCCcCCC
Q 046153 8 CGRNCGCGSSCKCGSD-YNVCRMYPD 32 (81)
Q Consensus 8 ~~gnCgCGs~C~CGsg-C~gCkMyPD 32 (81)
.+++|.||++|+|... |..|+.+.+
T Consensus 7 ~g~~C~Cgs~CkC~~~kC~sC~k~~~ 32 (51)
T KOG4738|consen 7 KGGSCTCGSSCKCSDCKCTSCKKSCC 32 (51)
T ss_pred CCCccccCCccccCCCccCCcCCccc
Confidence 3499999999999877 766776643
No 4
>PF02067 Metallothio_5: Metallothionein family 5; InterPro: IPR000966 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ] species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class I MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. Diptera (Drosophila, family 5) MTs are 40-43 residue proteins that contain 10 conserved cysteines arranged in five Cys-X-Cys groups. In particular, the consensus pattern C-G-x(2)-C-x-C-x(2)-Q-x(5)-C-x-C-x(2)-D-C-x-C has been found to be diagnostic of family 5 MTs. The protein is found primarily in the alimentary canal, and its induction is stimulated by ingestion of cadmium or copper []. Mercury, silver and zinc induce the protein to a lesser extent. Family 5 includes subfamilies: d1, d2. Only one d2 is known until now. Subfamilies hit the same entry.; GO: 0046872 metal ion binding
Probab=85.34 E-value=0.51 Score=27.64 Aligned_cols=14 Identities=57% Similarity=1.626 Sum_probs=10.2
Q ss_pred CCCCccCCCCCCcC
Q 046153 8 CGRNCGCGSSCKCG 21 (81)
Q Consensus 8 ~~gnCgCGs~C~CG 21 (81)
|++||+|++.|+|+
T Consensus 17 cg~~C~C~~dC~C~ 30 (41)
T PF02067_consen 17 CGGNCACNQDCKCV 30 (41)
T ss_pred cCCCccCCCCcccc
Confidence 44778888887775
No 5
>PF05522 Metallothio_6: Metallothionein; InterPro: IPR017980 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs [see http://www.bioc.unizh.ch/mtpage/protali.html]. Echinoidea (sea urchin, family 4) MTs are 64-67 residue proteins. Members of this family are recognised by the sequence pattern P-D-x-K-C-[V,F]-C-C-x(5)-C-x-C-x(4)-C-C-x(4)-C-C-x(4,6)-C-C located near the N terminus. The taxonomic range of the members extends to sea urchins (echinodea). The protein sequence is divided into two structural domains, each containing 9 and 11 Cys residues binding 3 and 4 bivalent metal ions, respectively. Family 4 includes subfamilies: e1, e2, they are separate phylogenetic groups. This entry includes the sea urchin proteins, and related sequences from worms.; PDB: 1QJK_A 1QJL_A.
Probab=84.84 E-value=0.46 Score=30.22 Aligned_cols=19 Identities=42% Similarity=1.232 Sum_probs=6.7
Q ss_pred CCCccCCCCCCcCCCCCCCC
Q 046153 9 GRNCGCGSSCKCGSDYNVCR 28 (81)
Q Consensus 9 ~gnCgCGs~C~CGsgC~gCk 28 (81)
+.+|.||.+|||+.++ +|+
T Consensus 41 NA~CKCga~CKC~~G~-~Ct 59 (65)
T PF05522_consen 41 NAACKCGAGCKCGGGC-GCT 59 (65)
T ss_dssp -TT----TT--TTS-----B
T ss_pred cccccccCCceeCCCC-ccc
Confidence 4789999999999987 564
No 6
>PF03940 MSSP: Male specific sperm protein; InterPro: IPR005634 This is a family of Drosophila proteins, that are typified by the repetitive motif C-G-P.
Probab=34.46 E-value=45 Score=19.91 Aligned_cols=19 Identities=32% Similarity=0.725 Sum_probs=11.0
Q ss_pred CCccCCCCCCcCCCCCCCC
Q 046153 10 RNCGCGSSCKCGSDYNVCR 28 (81)
Q Consensus 10 gnCgCGs~C~CGsgC~gCk 28 (81)
--.+|++-..||+-||.|.
T Consensus 8 pcg~cgpc~~cgpccg~cg 26 (48)
T PF03940_consen 8 PCGGCGPCGGCGPCCGPCG 26 (48)
T ss_pred cccCccCcccCcCcccCcC
Confidence 3345565556676666663
No 7
>TIGR03601 B_an_ocin probable heterocycle-containing bacteriocin, BA_2677 family. Numerous bacteria encode systems for producing bacteriocins by extensive modification of ribosomally produced precursors. These proteins are recognizable in part by proximity to the modification proteins, and in part by small size, with leader peptide-like N-terminal sequence followed by low-complexity sequence rich in Cys, Gly, and/or Ser. This protein family represents a probable member of the class, though previously unrecognized because it is not encoded adjacent to its modification proteins.
Probab=27.85 E-value=60 Score=21.25 Aligned_cols=21 Identities=29% Similarity=0.743 Sum_probs=9.3
Q ss_pred CCCCCccCCCCCCcC-CCCCCC
Q 046153 7 NCGRNCGCGSSCKCG-SDYNVC 27 (81)
Q Consensus 7 ~~~gnCgCGs~C~CG-sgC~gC 27 (81)
+|++-.+||-.|.++ -.|+||
T Consensus 44 gCGgcggcgG~c~~~g~rCgGC 65 (79)
T TIGR03601 44 GCGGGGCCGGRCGGCGGRCGGC 65 (79)
T ss_pred CCCCCCCCCCCcCCcCccccCc
Confidence 344444555555433 224444
No 8
>PF02068 Metallothio_PEC: Plant PEC family metallothionein; InterPro: IPR000316 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , , ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as MTs from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs. Family 15 consists of planta MTs. Its members are recognised by the sequence pattern [YFH]-x(5,25)-C-[SKD]-C-[GA]-[SDPAT]-x(0,1)-C-x-[CYF] which yields all plant sequences, but also MTCU_HELPO and the non-MT ITB3_HUMAN. The taxonomic range of the members extends to planta. Planta MTs are 45-84 residue proteins, containing 17 conserved cysteines that bind 5 zinc ions. Generally, there are two Cys-rich regions (domain 1 and domain 3) separated by a Cys-poor region (domain 2) and only the domain 2 contains unusual residues. It is believed that the proteins may have a role in Zn2+ homeostasis during embryogenesis. Family 15 includes the following subfamilies: p1, p2, p2v, p3, pec, p21. ; GO: 0008270 zinc ion binding; PDB: 2L62_A 2KAK_A 2L61_A.
Probab=24.34 E-value=56 Score=21.34 Aligned_cols=22 Identities=32% Similarity=0.927 Sum_probs=14.6
Q ss_pred CCCCccCCCCCCcCCCCCCCCcC
Q 046153 8 CGRNCGCGSSCKCGSDYNVCRMY 30 (81)
Q Consensus 8 ~~gnCgCGs~C~CGsgC~gCkMy 30 (81)
|+..|||..=|-.|+.| .|.|-
T Consensus 2 Cdd~CGC~vPCpgG~~C-rC~~~ 23 (76)
T PF02068_consen 2 CDDRCGCPVPCPGGTAC-RCTSS 23 (76)
T ss_dssp --GGGSS-SS-SSSTTS-CCCS-
T ss_pred CcCCcCCCccCCCCCcc-ccccc
Confidence 66889999999999999 67665
No 9
>PF15193 FAM24: FAM24 family
Probab=22.90 E-value=32 Score=22.09 Aligned_cols=12 Identities=33% Similarity=0.764 Sum_probs=9.5
Q ss_pred CCCCCCcCCCCC
Q 046153 23 DYNVCRMYPDLS 34 (81)
Q Consensus 23 gC~gCkMyPDl~ 34 (81)
-|-.|+||.|+.
T Consensus 45 ccd~C~mYad~d 56 (69)
T PF15193_consen 45 CCDECSMYADFD 56 (69)
T ss_pred hhhhhcccccCC
Confidence 367889999984
No 10
>PF09791 Oxidored-like: Oxidoreductase-like protein, N-terminal; InterPro: IPR019180 This entry represents the N-terminal domain of various oxidoreductase-like proteins whose exact function is, as yet, unknown.
Probab=21.21 E-value=44 Score=19.71 Aligned_cols=8 Identities=50% Similarity=1.219 Sum_probs=5.7
Q ss_pred cCCCCCCC
Q 046153 20 CGSDYNVC 27 (81)
Q Consensus 20 CGsgC~gC 27 (81)
|||||..|
T Consensus 19 CgSGC~~C 26 (48)
T PF09791_consen 19 CGSGCAPC 26 (48)
T ss_pred cccCCccc
Confidence 66777766
No 11
>PF01754 zf-A20: A20-like zinc finger; InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents the zinc finger domain found in A20. A20 is an inhibitor of cell death that inhibits NF-kappaB activation via the tumour necrosis factor receptor associated factor pathway []. The zinc finger domains appear to mediate self-association in A20. These fingers also mediate IL-1-induced NF-kappa B activation. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 2FIF_F 2FID_B 2C7N_C 2C7M_A 2L00_A 2KZY_A 2EQG_A 2EQE_A 3OJ3_J 3OJ4_C ....
Probab=21.05 E-value=45 Score=17.30 Aligned_cols=11 Identities=18% Similarity=0.247 Sum_probs=6.9
Q ss_pred CCCCCCccccC
Q 046153 71 KCKFYKNFFLN 81 (81)
Q Consensus 71 KCGsnc~~~~~ 81 (81)
+|..+|.||.|
T Consensus 3 ~C~~gCgf~Gs 13 (25)
T PF01754_consen 3 LCANGCGFYGS 13 (25)
T ss_dssp B-TTTSSSB-B
T ss_pred cccCCCCCccc
Confidence 46788888864
Done!