BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046158
         (542 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1UWX|K Chain K, P1.2 Serosubtype Antigen Derived From N. Meningitidis Pora
           In Complex With Fab Fragment
 pdb|1UWX|L Chain L, P1.2 Serosubtype Antigen Derived From N. Meningitidis Pora
           In Complex With Fab Fragment
          Length = 213

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 207 FANGLEARMAGSGTGTK-SFLMSLAPRKSAADMLKAYKVYLSACPFKKLAIMFTIKMIMK 265
            A+G+ +R +GSG+GTK SF +S      A D +  Y   LS+ P+         K+ +K
Sbjct: 54  LADGVPSRFSGSGSGTKFSFKIS---SLQAEDFVSYYCQQLSSTPY---TFGGGTKLEIK 107

Query: 266 VSEKASTLHI 275
            ++ A T+ I
Sbjct: 108 RADAAPTVSI 117


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,570,401
Number of Sequences: 62578
Number of extensions: 646449
Number of successful extensions: 1788
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1788
Number of HSP's gapped (non-prelim): 4
length of query: 542
length of database: 14,973,337
effective HSP length: 104
effective length of query: 438
effective length of database: 8,465,225
effective search space: 3707768550
effective search space used: 3707768550
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)