Citrus Sinensis ID: 046188


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640------
MEQYSLYTYLSIWLMILCTFLHDLQQSNCQQTYLDNVQLDCYKSVSISKGYLCNGPQKLCQSFITFRSQPPFNTPVSIAYLLGSDASIIVPVSCSCSGSLYQHNAPYTIKANDTYFLVANNTYQGLTTCQALLGQNYYDEKNLGSGLEVIVPLRCACPTAKQIDNGVSYLLAYMATWGDTISSIGHKFGADKQSILDANKLSEDDLIFTFTPLLIPLKSESCSANPEKFFCQCKNGFLVDEMLKGLHCKPDGKKFPVKLVTLLGLGIGLGFLSLVLLGCYLYKVIGAKRSRMLKEKLFKQNGGYLLQQRLSSCGSSEKAKIFTAEELQRATDNYNQSRFLGQGGFGTVYKGMLPDGSIVAVKRSKAIDKTQIEQFINEVVILSQINHRHIVKLLGCCLETEVPVLVYEYICNGNLSHHIHDHQQQQEQKQELEEEQELSSLSWENRVRVACEVAGAVAYMHSSASIPIFHRDIKSSNILLDDKFSAKVSDFGTSRSVPNDKTHLTTAVQGTFGYFDPEYFQSSQYTDKSDVYSFGVVLLELLTGKKPICLTREEEERNLVAYFISLAKENKLLEILDARVAKEASEEDIEAVAELAMGCLRLNSKKRPTMKQVSMDLEGLRRSQRCLEIGKVNQLLTNEISLAQNS
cccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHHHHccccccEEEEEccccccccccccccEEEECccEEEEEEccccccccHHHHHHcccccccccccccccEEcccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHHHcccccccccCEEEcHHHHHHHHcccccccccccccccCEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEcccccHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccEEccccccccccccccccEEEccccccccccccccEEEEEcccccccccHHHHcccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
***YSLYTYLSIWLMILCTFLHDLQQSNCQQTYLDNVQLDCYKSVSISKGYLCNGPQKLCQSFITFRSQPPFNTPVSIAYLLGSDASIIVPVSCSCSGSLYQHNAPYTIKANDTYFLVANNTYQGLTTCQALLGQNYYDEKNLGSGLEVIVPLRCACPTAKQIDNGVSYLLAYMATWGDTISSIGHKFGADKQSILDANKLSEDDLIFTFTPLLIPLKSESCSANPEKFFCQCKNGFLVDEMLKGLHCKPDGKKFPVKLVTLLGLGIGLGFLSLVLLGCYLYKVIGAKR******************************KIFTAEELQRATDNYNQSRFLGQGGFGTVYKGMLPDGSIVAVKRSKAIDKTQIEQFINEVVILSQINHRHIVKLLGCCLETEVPVLVYEYICNGNLSHHIHDHQQQQEQKQELEEEQELSSLSWENRVRVACEVAGAVAYMHSSASIPIFHRDIKSSNILLDDKFSAKVSDFGTSRSVPNDKTHLTTAVQGTFGYFDPEYFQSSQYTDKSDVYSFGVVLLELLTGKKPICL**EEEERNLVAYFISLAKENKLLEILDARVAKEASEEDIEAVAELAMGCLRLNSKKRPTMKQVSMDLEG***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQYSLYTYLSIWLMILCTFLHDLQQSNCQQTYLDNVQLDCYKSVSISKGYLCNGPQKLCQSFITFRSQPPFNTPVSIAYLLGSDASIIVPVSCSCSGSLYQHNAPYTIKANDTYFLVANNTYQGLTTCQALLGQNYYDEKNLGSGLEVIVPLRCACPTAKQIDNGVSYLLAYMATWGDTISSIGHKFGADKQSILDANKLSEDDLIFTFTPLLIPLKSESCSANPEKFFCQCKNGFLVDEMLKGLHCKPDGKKFPVKLVTLLGLGIGLGFLSLVLLGCYLYKVIGAKRSRMLKEKLFKQNGGYLLQQRLSSCGSSEKAKIFTAEELQRATDNYNQSRFLGQGGFGTVYKGMLPDGSIVAVKRSKAIDKTQIEQFINEVVILSQINHRHIVKLLGCCLETEVPVLVYEYICNGNxxxxxxxxxxxxxxxxxxxxxQELSSLSWENRVRVACEVAGAVAYMHSSASIPIFHRDIKSSNILLDDKFSAKVSDFGTSRSVPNDKTHLTTAVQGTFGYFDPEYFQSSQYTDKSDVYSFGVVLLELLTGKKPICLTREEEERNLVAYFISLAKENKLLEILDARVAKEASEEDIEAVAELAMGCLRLNSKKRPTMKQVSMDLEGLRRSQRCLEIGKVNQLLTNEISLAQNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 318-425,438-621
View the alignment between query and template
View the model in PyMOL
Template: 3TT0, chain A
Confidence level:very confident
Coverage over the Query: 330-555,572-628
View the alignment between query and template
View the model in PyMOL
Template: 4EBY, chain A
Confidence level:very confident
Coverage over the Query: 58-226
View the alignment between query and template
View the model in PyMOL
Template: 1AD5, chain A
Confidence level:probable
Coverage over the Query: 298-432,447-495,506-547
View the alignment between query and template
View the model in PyMOL