Citrus Sinensis ID: 046199

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900--

AANNINTTDQQALLALKARITAKNWTSNTSVCSWIGITCDVSTHRVTALNISDFGLTGTISSQLGNLSSLQTLDLSHNRFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNTSSLRAIDCNYNSLSGELPANIFRAIPKDIGNLTKLKELYLGYNKLQGEIPQELGNLAELEWLSLPRSFLTGTIPSSIFNLSSLLELDFSNNSLTGFYMTNNHFTGSIPRNLWQCEIPHEIGNLPNLEVLGIDENHLVGDVPNTIFNMSTLKALSLLNNTLSGSLPSSSKNLIGLPNIERLNLGLNNLSGRIPGFIFNASKLFLLELTGNSFSGFIPDTLVNLRNLEHLGLGYNYLTSSTPELSFLSSLANSSSSKYIVLAENPLNGVLPSSIGNLPITLEEIYLQNCKIRGNIPKEIGNLVNLTTLHLGNNQLSGSIPITVGRLNTLQGLGLENNKLEGPIPDDLCQLSELHVDHNKLSGPIPACFGNLNSLRNLSLGSNELSSFIPSTFWNLNNILSFDFSSNSLNGSLPLDIGNMKVVVEINLSRNYLTGDIPTTIGGLTNLQLLSLENNRLHGPIPESFGALTSLESLDLSVNNLSGVIPISLEKLVYLKDLNLSFNRLEGEIPSGGSFANFSAQSFMGNDLLCGSPHLQVPLCKSSPHQKSSKNVILLGVVLPLSVFIIAILLALGIGLITRYRKGNTELSNIEVNMSPQAMWRRFSYRELLLATDHFSEKSLIGIGSFGTVYKGRFLDGMEVAIKVFHLQFDGALKSFDAECEVLKSVRHRNLVKIISSCSNGNFKALVLEYMANGSLEKCLYSSNRSLDIFQRLSIMIDVALALEYLHFGYSNPVVHCDIKPSNILLDDDMVAHLSDFGIAKLLNGEESMRTQTLGTIGYMAPGLWVVLN

ccccccHHHHHHHHHHHHccccccccccccccccEEEEcccccccEEEEEcccccccCCccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEccccccCCcccccccccccccEEEccccccccccccccccccccccEEccccccccccccccccccccccccccccccHHccccccccEEEcccccccccccHHHHcccccccEEccccccccccccccccccccccccEEEccccCEECcccHHHHHcccccEEEccccCEECcccccccccccccEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEEccCEEECccccccccccccEEEccccCCcccccccccccccccEEEccccccCCccccccccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccccEEEcccccEEEEEEEccccEEEEEEEccccccccHHHHHHHHHHHcccccccccEEEEEEcccccEEEEcccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccECccccccccccccccEEEcccccccccccccccccccccccccccccHHHcccc

******TTDQQALLALKARITAKNWTSNTSVCSWIGITCDVSTHRVTALNISDFGLTGTISSQLGNLSSLQTLDLSHNRFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNTSSLRAIDCNYNSLSGELPANIFRAIPKDIGNLTKLKELYLGYNKLQGEIPQELGNLAELEWLSLPRSFLTGTIPSSIFNLSSLLELDFSNNSLTGFYMTNNHFTGSIPRNLWQCEIPHEIGNLPNLEVLGIDENHLVGDVPNTIFNMSTLKALSLLNNTLSGSLPSSSKNLIGLPNIERLNLGLNNLSGRIPGFIFNASKLFLLELTGNSFSGFIPDTLVNLRNLEHLGLGYNYLTSSTPELSFLSSLANSSSSKYIVLAENPLNGVLPSSIGNLPITLEEIYLQNCKIRGNIPKEIGNLVNLTTLHLGNNQLSGSIPITVGRLNTLQGLGLENNKLEGPIPDDLCQLSELHVDHNKLSGPIPACFGNLNSLRNLSLGSNELSSFIPSTFWNLNNILSFDFSSNSLNGSLPLDIGNMKVVVEINLSRNYLTGDIPTTIGGLTNLQLLSLENNRLHGPIPESFGALTSLESLDLSVNNLSGVIPISLEKLVYLKDLNLSFNRLEGEIPSGGSFANFSAQSFMGNDLLCGSPHLQVPLC*********KNVILLGVVLPLSVFIIAILLALGIGLITRYRKG*************QAMWRRFSYRELLLATDHFSEKSLIGIGSFGTVYKGRFLDGMEVAIKVFHLQFDGALKSFDAECEVLKSVRHRNLVKIISSCSNGNFKALVLEYMANGSLEKCLYSSNRSLDIFQRLSIMIDVALALEYLHFGYSNPVVHCDIKPSNILLDDDMVAHLSDFGIAKLLNGEESMRTQTLGTIGYMAPGLWVVL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XKU, chain A
Confidence level:very confident
Coverage over the Query: 263-354,385-523,549-613
View the alignment between query and template
View the model in PyMOL

Template: 1XKU, chain A
Confidence level:very confident
Coverage over the Query: 150-211,232-448
View the alignment between query and template
View the model in PyMOL

Template: 3ZYJ, chain A
Confidence level:very confident
Coverage over the Query: 293-353,383-454,475-596
View the alignment between query and template
View the model in PyMOL

Template: 3E6J, chain A
Confidence level:very confident
Coverage over the Query: 24-42,55-210
View the alignment between query and template
View the model in PyMOL

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 48-212,223-647
View the alignment between query and template
View the model in PyMOL

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 6-131,146-208,219-352,383-463,477-545,564-620
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 4-208,219-657
View the alignment between query and template
View the model in PyMOL

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 713-899
View the alignment between query and template
View the model in PyMOL

Template: 3RIZ, chain A
Confidence level:confident
Coverage over the Query: 36-595,620-654
View the alignment between query and template
View the model in PyMOL

Template: 3TL8, chain A
Confidence level:confident
Coverage over the Query: 712-895
View the alignment between query and template
View the model in PyMOL