Query         046218
Match_columns 437
No_of_seqs    180 out of 960
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:51:05 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046218.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046218hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 6.6E-43 1.4E-47  303.4   5.5  124   19-142     1-129 (129)
  2 PHA00692 hypothetical protein   24.1      29 0.00063   28.3   0.3   12   15-26     33-44  (74)
  3 smart00265 BH4 BH4 Bcl-2 homol  20.4   1E+02  0.0022   21.3   2.3   20   28-47      4-23  (27)
  4 COG4598 HisP ABC-type histidin  13.0 2.2E+02  0.0047   28.6   3.4   42    2-43    153-200 (256)
  5 COG1126 GlnQ ABC-type polar am  12.5 2.4E+02  0.0053   28.5   3.7   44    2-45    137-186 (240)
  6 PF12672 DUF3793:  Protein of u  11.6 1.3E+02  0.0029   28.4   1.5   60   22-103    83-143 (176)
  7 PF02180 BH4:  Bcl-2 homology r  11.1 2.1E+02  0.0045   20.0   1.9   19   29-47      5-23  (27)
  8 PF07960 CBP4:  CBP4;  InterPro  10.0 1.5E+02  0.0032   27.4   1.2   14   23-36     26-40  (128)
  9 PHA03357 Alkaline exonuclease;  10.0 1.2E+02  0.0026   25.8   0.6   37  391-435    29-65  (81)
 10 PF08338 DUF1731:  Domain of un   9.6   2E+02  0.0044   21.8   1.6   16   21-36     31-47  (48)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=6.6e-43  Score=303.37  Aligned_cols=124  Identities=46%  Similarity=0.998  Sum_probs=96.2

Q ss_pred             CCCCceeCCCHHHHHHHHHHhhhcCCCCCC-CceeecCCCCCCCCCcccc---cCceEEeecCccccCCCCCCCcccccc
Q 046218           19 FPPGYRFCPTDKELVLDYLKNKAMNKPLPP-NKIMDINLYNHGPQDLSEQ---EEKTLYFFTPRDRKYPKGTRPNRAAGR   94 (437)
Q Consensus        19 LPPGFRF~PTDEELV~~YLrrKi~G~Plp~-~iI~EvDVY~~dPWELp~~---ge~EWYFFSpR~rKy~nG~R~nRatGg   94 (437)
                      |||||||+|||||||.+||++|+.|.+++. .+|+++|||++|||+|+..   ++++||||+++++++.+|.|.+|++++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r~~R~~~~   80 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNGGRPNRVTGG   80 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHSSS-SSEEEEEEE----------S-EEETT
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhccCCCceEEEEEecccccCCcccccccccc
Confidence            899999999999999999999999999888 7999999999999999943   677999999999999999999999999


Q ss_pred             ceeEecCCCeeecC-CCCceeEEEEEEEeeCCCCCCCCcCeEEEEEEeC
Q 046218           95 GYWKATGVDNIIGR-KENPIGYRKSLVYYQGYPKKSKKTNWIMHEYRID  142 (437)
Q Consensus        95 GyWKatG~dK~I~s-~g~vVG~KKtLvFY~GkaprG~KTgWVMhEYrL~  142 (437)
                      |+||.+|++++|.+ .+++||+||+|+||.++.+++.||+|+||||+|.
T Consensus        81 G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   81 GYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             eEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            99999999999998 6899999999999999888999999999999984


No 2  
>PHA00692 hypothetical protein
Probab=24.13  E-value=29  Score=28.28  Aligned_cols=12  Identities=50%  Similarity=1.373  Sum_probs=9.9

Q ss_pred             hcccCCCCceeC
Q 046218           15 YLNSFPPGYRFC   26 (437)
Q Consensus        15 ~~~~LPPGFRF~   26 (437)
                      ++-..||||||-
T Consensus        33 yfveyppgfrfg   44 (74)
T PHA00692         33 YFVEYPPGFRFG   44 (74)
T ss_pred             EeEecCCCcccc
Confidence            456899999995


No 3  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=20.37  E-value=1e+02  Score=21.34  Aligned_cols=20  Identities=30%  Similarity=0.512  Sum_probs=15.8

Q ss_pred             CHHHHHHHHHHhhhcCCCCC
Q 046218           28 TDKELVLDYLKNKAMNKPLP   47 (437)
Q Consensus        28 TDEELV~~YLrrKi~G~Plp   47 (437)
                      +-.|||.+|+.-|+.....+
T Consensus         4 ~nRelV~~yv~yKLsQrgy~   23 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCC
Confidence            45799999999999765443


No 4  
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=13.04  E-value=2.2e+02  Score=28.61  Aligned_cols=42  Identities=43%  Similarity=0.427  Sum_probs=31.9

Q ss_pred             ccHHHHHHHHHHhhcccCCCCceeC-CC---HHHHHHHHHH--hhhcC
Q 046218            2 VSVEQQQRVAMLKYLNSFPPGYRFC-PT---DKELVLDYLK--NKAMN   43 (437)
Q Consensus         2 ~~~~~~q~~am~~~~~~LPPGFRF~-PT---DEELV~~YLr--rKi~G   43 (437)
                      .|+-|||+.+++--+.--|-=.=|+ ||   |-|||..-|+  ++++.
T Consensus       153 LSGGQQQR~aIARaLameP~vmLFDEPTSALDPElVgEVLkv~~~LAe  200 (256)
T COG4598         153 LSGGQQQRVAIARALAMEPEVMLFDEPTSALDPELVGEVLKVMQDLAE  200 (256)
T ss_pred             cCchHHHHHHHHHHHhcCCceEeecCCcccCCHHHHHHHHHHHHHHHH
Confidence            4788999999986666666667787 77   7899998887  44543


No 5  
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=12.48  E-value=2.4e+02  Score=28.53  Aligned_cols=44  Identities=39%  Similarity=0.380  Sum_probs=32.7

Q ss_pred             ccHHHHHHHHHHhhcccCCCCceeC-CC---HHHHHHHHHH--hhhcCCC
Q 046218            2 VSVEQQQRVAMLKYLNSFPPGYRFC-PT---DKELVLDYLK--NKAMNKP   45 (437)
Q Consensus         2 ~~~~~~q~~am~~~~~~LPPGFRF~-PT---DEELV~~YLr--rKi~G~P   45 (437)
                      .|+-||||+|++--+.==|.=.=|+ ||   |=|||...|.  +.++.+.
T Consensus       137 LSGGQqQRVAIARALaM~P~vmLFDEPTSALDPElv~EVL~vm~~LA~eG  186 (240)
T COG1126         137 LSGGQQQRVAIARALAMDPKVMLFDEPTSALDPELVGEVLDVMKDLAEEG  186 (240)
T ss_pred             cCcHHHHHHHHHHHHcCCCCEEeecCCcccCCHHHHHHHHHHHHHHHHcC
Confidence            5889999999996665556666788 87   7899988877  4444443


No 6  
>PF12672 DUF3793:  Protein of unknown function (DUF3793);  InterPro: IPR024523 This family of bacterial proteins is functionally uncharacterised. The proteins in this family contain two conserved sequence motifs: PHE and LGYP.
Probab=11.61  E-value=1.3e+02  Score=28.41  Aligned_cols=60  Identities=25%  Similarity=0.469  Sum_probs=34.2

Q ss_pred             CceeCCCHHHHHHHHHHhhhcCCCCCCCceeecCCC-CCCCCCcccccCceEEeecCccccCCCCCCCccccccceeEec
Q 046218           22 GYRFCPTDKELVLDYLKNKAMNKPLPPNKIMDINLY-NHGPQDLSEQEEKTLYFFTPRDRKYPKGTRPNRAAGRGYWKAT  100 (437)
Q Consensus        22 GFRF~PTDEELV~~YLrrKi~G~Plp~~iI~EvDVY-~~dPWELp~~ge~EWYFFSpR~rKy~nG~R~nRatGgGyWKat  100 (437)
                      ||  .+.+-|-+...|+.|+.+..+|    ||+-|+ ++...|.-+       |....         .......||||..
T Consensus        83 GY--~~~~~~~~L~~L~~R~~~~~FP----HEIGiFLGYPleDV~G-------FI~~~---------g~~~~~~GyWKVY  140 (176)
T PF12672_consen   83 GY--PDSSLEDCLEHLKKRFESGEFP----HEIGIFLGYPLEDVKG-------FIENK---------GKNCKCCGYWKVY  140 (176)
T ss_pred             Cc--CCCCHHHHHHHHHHHhcCCCCC----chhHhccCCCHHHHHH-------HHhCC---------CCCeeEeccCccC
Confidence            77  5555554556788888666565    555555 444444332       33211         1223457999987


Q ss_pred             CCC
Q 046218          101 GVD  103 (437)
Q Consensus       101 G~d  103 (437)
                      |-.
T Consensus       141 ~n~  143 (176)
T PF12672_consen  141 GNP  143 (176)
T ss_pred             CCH
Confidence            654


No 7  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=11.15  E-value=2.1e+02  Score=19.95  Aligned_cols=19  Identities=32%  Similarity=0.487  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHhhhcCCCCC
Q 046218           29 DKELVLDYLKNKAMNKPLP   47 (437)
Q Consensus        29 DEELV~~YLrrKi~G~Plp   47 (437)
                      -.|||.+|+.-|+.....+
T Consensus         5 nR~lV~~yi~yKLsQrgy~   23 (27)
T PF02180_consen    5 NRELVEDYISYKLSQRGYV   23 (27)
T ss_dssp             HHHHHHHHHHHHHHHTTST
T ss_pred             HHHHHHHHHHHHhhhcCCC
Confidence            4799999999998655443


No 8  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=9.97  E-value=1.5e+02  Score=27.37  Aligned_cols=14  Identities=36%  Similarity=0.793  Sum_probs=10.6

Q ss_pred             cee-CCCHHHHHHHH
Q 046218           23 YRF-CPTDKELVLDY   36 (437)
Q Consensus        23 FRF-~PTDEELV~~Y   36 (437)
                      |++ .||||||+..|
T Consensus        26 ~~y~tPTeEeL~~r~   40 (128)
T PF07960_consen   26 VKYTTPTEEELFKRY   40 (128)
T ss_pred             heecCCCHHHHHHhc
Confidence            444 49999999865


No 9  
>PHA03357 Alkaline exonuclease; Provisional
Probab=9.97  E-value=1.2e+02  Score=25.79  Aligned_cols=37  Identities=41%  Similarity=0.751  Sum_probs=27.8

Q ss_pred             ccccccccccccccchhHHHHHHhhhccccceeecCCCCCCCCCC
Q 046218          391 NVMLDQQFFHDYDYTSSLFEEVWNNCLVDLPVIEFPPSNFDDVKD  435 (437)
Q Consensus       391 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  435 (437)
                      =|-||..+|.||+     |+|-|+. +-|.|  .||.-||-|+|.
T Consensus        29 tvaLdad~FEdF~-----lDE~~~e-~~~~~--~~~~~~~~~~~~   65 (81)
T PHA03357         29 TLALNADCFEDFD-----FDENTNE-AADKP--DFPKPNFIDPKN   65 (81)
T ss_pred             EEEeChhhhhccc-----cccccCc-cccCc--CCCCCcccCCCc
Confidence            3668999999998     4677865 34544  688889999875


No 10 
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=9.57  E-value=2e+02  Score=21.75  Aligned_cols=16  Identities=38%  Similarity=0.673  Sum_probs=9.2

Q ss_pred             CCceeC-CCHHHHHHHH
Q 046218           21 PGYRFC-PTDKELVLDY   36 (437)
Q Consensus        21 PGFRF~-PTDEELV~~Y   36 (437)
                      -||+|+ |+=++-+.+-
T Consensus        31 ~GF~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   31 AGFQFRYPTLEEALRDL   47 (48)
T ss_dssp             TT---S-SSHHHHHHH-
T ss_pred             CCCcccCCCHHHHHhcc
Confidence            599998 8888876653


Done!