Query         046225
Match_columns 73
No_of_seqs    101 out of 325
Neff          6.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:55:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046225.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046225hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14178 YppF:  YppF-like prote  77.7     1.2 2.6E-05   25.8   0.9   29    2-30     12-40  (60)
  2 PF00821 PEPCK:  Phosphoenolpyr  71.3    0.78 1.7E-05   36.7  -1.2   43   20-63    455-509 (586)
  3 COG2922 Smg Uncharacterized pr  68.9     3.4 7.3E-05   27.9   1.6   48    2-50     69-121 (157)
  4 KOG3749 Phosphoenolpyruvate ca  68.6     1.5 3.2E-05   35.0  -0.2   30   34-64    524-564 (640)
  5 PHA02503 putative transcriptio  61.5      13 0.00028   20.9   2.8   22   13-42     24-45  (57)
  6 cd00819 PEPCK_GTP Phosphoenolp  58.4     2.2 4.7E-05   34.2  -0.9   28   35-63    471-509 (579)
  7 PRK04210 phosphoenolpyruvate c  55.8     3.1 6.7E-05   33.5  -0.5   42   21-63    470-523 (601)
  8 PF04761 Phage_Treg:  Lactococc  49.9      24 0.00053   19.9   2.7   22   13-42     24-45  (57)
  9 smart00735 ZM ZASP-like motif.  48.3       8 0.00017   18.3   0.5   15    2-16     10-24  (26)
 10 PF13865 FoP_duplication:  C-te  47.3      14 0.00029   21.7   1.4   12    7-18     41-52  (74)
 11 PF02865 STAT_int:  STAT protei  45.7      24 0.00053   22.6   2.6   56   10-67     62-117 (124)
 12 PRK09885 putative toxin YafO;   42.7      16 0.00035   24.1   1.4   39    2-40      1-39  (132)
 13 TIGR03687 pupylate_cterm ubiqu  41.4      40 0.00086   17.2   2.4   19    9-27     10-28  (33)
 14 cd03742 SOCS_Rab40 SOCS (suppr  35.8      60  0.0013   17.4   2.7   35   15-49      6-41  (43)
 15 PF14502 HTH_41:  Helix-turn-he  34.5      30 0.00065   19.0   1.5   27   40-67      9-35  (48)
 16 TIGR03544 DivI1A_domain DivIVA  34.5      35 0.00076   16.9   1.6   20    3-22     15-34  (34)
 17 PF14804 Jag_N:  Jag N-terminus  33.8      30 0.00065   19.0   1.4   18    6-23      2-19  (52)
 18 PF05553 DUF761:  Cotton fibre   33.4      40 0.00088   17.6   1.8   14   12-25      2-15  (38)
 19 PHA00212 putative transcriptio  32.8      72  0.0016   18.2   2.8   11   39-49     28-38  (63)
 20 PRK03430 hypothetical protein;  31.7      34 0.00074   23.0   1.6   47    2-49     69-120 (157)
 21 PF10364 NKWYS:  Putative capsu  30.2 1.6E+02  0.0034   19.6   4.6   46    4-50     71-121 (141)
 22 COG4574 Eco Serine protease in  30.1      18  0.0004   24.3   0.1   12    1-12    133-144 (162)
 23 cd00059 FH Forkhead (FH), also  29.2      38 0.00083   20.0   1.4   18   31-48     19-36  (78)
 24 PRK11467 secY/secA suppressor   28.9      68  0.0015   20.8   2.6   24    9-32      5-28  (124)
 25 TIGR03499 FlhF flagellar biosy  28.9      54  0.0012   23.2   2.4   30    1-30      1-30  (282)
 26 smart00253 SOCS suppressors of  28.5      95  0.0021   16.1   2.9   33   15-47     10-43  (43)
 27 COG3408 GDB1 Glycogen debranch  28.3      71  0.0015   25.9   3.1   37   12-50    248-288 (641)
 28 PF00714 IFN-gamma:  Interferon  28.2      40 0.00087   22.4   1.5   45    4-48      6-67  (138)
 29 PF13984 MsyB:  MsyB protein     26.9      73  0.0016   20.6   2.5   27   10-36      4-30  (122)
 30 PF13531 SBP_bac_11:  Bacterial  26.9      75  0.0016   20.9   2.7   26    3-29      1-26  (230)
 31 COG1274 PckA Phosphoenolpyruva  26.4      11 0.00024   30.3  -1.7   42   21-63    478-531 (608)
 32 PF05028 PARG_cat:  Poly (ADP-r  25.7      43 0.00093   24.8   1.4   56    3-62    261-320 (340)
 33 PF15368 BioT2:  Spermatogenesi  25.4      97  0.0021   21.3   3.0   27   10-46    138-164 (170)
 34 PF08157 NUC129:  NUC129 domain  25.0 1.1E+02  0.0025   17.7   2.8   33   10-42     10-43  (63)
 35 PF11834 DUF3354:  Domain of un  24.8      63  0.0014   18.8   1.7   21    5-25     22-42  (69)
 36 KOG3467 Histone H4 [Chromatin   24.7 1.3E+02  0.0028   18.8   3.2   35   10-44     50-92  (103)
 37 PF13518 HTH_28:  Helix-turn-he  24.6      68  0.0015   16.2   1.8   22   44-65     19-40  (52)
 38 KOG0909 Peptide:N-glycanase [P  24.5      62  0.0013   25.7   2.1   35   13-47    120-155 (500)
 39 PRK09946 hypothetical protein;  24.5      78  0.0017   23.3   2.5   25   36-60     14-40  (270)
 40 smart00339 FH FORKHEAD. FORKHE  24.1      54  0.0012   19.7   1.4   18   31-48     19-36  (89)
 41 PF00976 ACTH_domain:  Corticot  23.7      17 0.00036   19.2  -0.7   12    2-14     19-30  (39)
 42 PF02639 DUF188:  Uncharacteriz  23.6      51  0.0011   21.3   1.3   14    4-17     79-92  (130)
 43 PF03513 Cloacin_immun:  Cloaci  23.3      42 0.00092   20.5   0.8   16   43-59     21-36  (82)
 44 PF06254 DUF1019:  Protein of u  23.3      47   0.001   20.4   1.1   13   37-49     11-23  (89)
 45 smart00070 GLUCA Glucagon like  23.1 1.1E+02  0.0023   14.7   2.4   15   11-25     10-25  (27)
 46 cd03739 SOCS_SOCS5 SOCS (suppr  22.8 1.5E+02  0.0032   16.8   3.0   35   15-49      6-41  (57)
 47 PF02671 PAH:  Paired amphipath  21.9 1.3E+02  0.0028   15.4   2.9   32   31-63     16-47  (47)
 48 PF12434 Malate_DH:  Malate deh  21.9 1.1E+02  0.0024   15.0   2.1   15    9-23     11-25  (28)
 49 PF07812 TfuA:  TfuA-like prote  21.6      64  0.0014   21.0   1.5   17   31-47     42-58  (120)
 50 PF00123 Hormone_2:  Peptide ho  21.5      78  0.0017   15.3   1.5   16   10-25      9-25  (28)
 51 PF05112 Baculo_p47:  Baculovir  21.4      48   0.001   24.9   0.9   31   33-63     92-133 (313)
 52 PF12630 Pox_polyA_pol_N:  Poxv  21.2      94   0.002   19.9   2.2   31   40-70     51-81  (108)
 53 PRK09480 slmA division inhibit  21.1 1.7E+02  0.0038   18.4   3.5   45    1-45      1-53  (194)
 54 PLN02557 phosphoribosylformylg  20.6      99  0.0022   23.4   2.5   29   31-59    311-339 (379)
 55 PF06034 DUF919:  Nucleopolyhed  20.2 1.5E+02  0.0032   17.1   2.7   19    9-27     41-59  (62)
 56 PF00250 Fork_head:  Fork head   20.2      75  0.0016   19.3   1.5   17   31-47     19-35  (96)
 57 PF14998 Ripply:  Transcription  20.1 1.5E+02  0.0033   18.2   2.8   27    1-27     42-70  (87)

No 1  
>PF14178 YppF:  YppF-like protein
Probab=77.69  E-value=1.2  Score=25.78  Aligned_cols=29  Identities=21%  Similarity=0.525  Sum_probs=24.7

Q ss_pred             ceeeechhhHHHHHHHHHHHHHhhhhccc
Q 046225            2 KVRVYTASEVESELEVAKREYLQAAVGIS   30 (73)
Q Consensus         2 ~vr~Yta~~l~~qL~~aa~~Fi~~~v~v~   30 (73)
                      .++=|.|+++++.|+-|.+-||++.+.+.
T Consensus        12 ~~k~y~p~~~NeLLDFar~~Yi~gei~i~   40 (60)
T PF14178_consen   12 QKKKYEPEDMNELLDFARKLYIQGEISIN   40 (60)
T ss_pred             HHhccCcccHHHHHHHHHHHHHhCcccHH
Confidence            35669999999999999999999876554


No 2  
>PF00821 PEPCK:  Phosphoenolpyruvate carboxykinase;  InterPro: IPR008209  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents GTP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004611 phosphoenolpyruvate carboxykinase activity, 0005525 GTP binding, 0006094 gluconeogenesis; PDB: 2FAH_A 2FAF_A 2QZY_B 2ZCI_D 3MOE_A 3DT7_B 2RKD_A 2RKA_A 2RK8_A 2QF2_B ....
Probab=71.34  E-value=0.78  Score=36.69  Aligned_cols=43  Identities=26%  Similarity=0.641  Sum_probs=28.2

Q ss_pred             HHHHhhhhcccCCe-eeehHHH--HHhHhh---------hhcChhHHHHHHHhcCc
Q 046225           20 REYLQAAVGISSEK-LAIPKLL--DWYLLD---------FAKDFESLLDWICLQSV   63 (73)
Q Consensus        20 ~~Fi~~~v~v~~~~-v~lskIf--~Wy~~D---------Fg~~~~~ll~~i~~yl~   63 (73)
                      -+|+++-..+.++. -.+||||  .||++|         ||.+ ..||+||.+...
T Consensus       455 gdY~~hwL~~~~~~~~k~PkIF~VNwFrk~~~G~flWPGfgen-~RVL~Wi~~R~~  509 (586)
T PF00821_consen  455 GDYLQHWLSMGKKLGRKLPKIFHVNWFRKDEDGKFLWPGFGEN-SRVLKWIERRVE  509 (586)
T ss_dssp             HHHHHHHHHHGGSTTGBS-EEEEEEST-B-TTSSBSS--GGGH-HHHHHHHHHHHT
T ss_pred             HHHHHHHHHhhcccccCCCcEEEEEeeEEcCCCccccCCCccc-HHHHHHHHHHhc
Confidence            35777755555332 6899999  899999         5555 579999997643


No 3  
>COG2922 Smg Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.91  E-value=3.4  Score=27.95  Aligned_cols=48  Identities=19%  Similarity=0.356  Sum_probs=34.6

Q ss_pred             ceeeechhhHHHHHHHHHHHHHhh---hhccc--CCeeeehHHHHHhHhhhhcC
Q 046225            2 KVRVYTASEVESELEVAKREYLQA---AVGIS--SEKLAIPKLLDWYLLDFAKD   50 (73)
Q Consensus         2 ~vr~Yta~~l~~qL~~aa~~Fi~~---~v~v~--~~~v~lskIf~Wy~~DFg~~   50 (73)
                      |+|+||++..+. |+..+|.|+.=   -..++  .+++.+.+++.-=...|.-+
T Consensus        69 ~lRIYt~EE~~r-L~~e~rGfllfLeq~~vl~~etREmVI~r~M~Ld~~E~~ld  121 (157)
T COG2922          69 ALRIYTPEECDR-LDAECRGFLLFLEQIQVLNLETREMVIERVMALDTDEIDLD  121 (157)
T ss_pred             ceEeeCHHHHhc-cCHHHHHHHHHHHHHcccChhHHHHHHHHHHcCCccccccc
Confidence            799999999875 78899988743   22233  66788888887655555544


No 4  
>KOG3749 consensus Phosphoenolpyruvate carboxykinase [Energy production and conversion]
Probab=68.65  E-value=1.5  Score=35.01  Aligned_cols=30  Identities=27%  Similarity=0.782  Sum_probs=24.0

Q ss_pred             eeehHHH--HHhHhh---------hhcChhHHHHHHHhcCcc
Q 046225           34 LAIPKLL--DWYLLD---------FAKDFESLLDWICLQSVV   64 (73)
Q Consensus        34 v~lskIf--~Wy~~D---------Fg~~~~~ll~~i~~yl~~   64 (73)
                      -.+||||  .||++|         ||.+ ..+++||.+-+..
T Consensus       524 ~~~PkIFhvNwfrk~~~gKfLWPGfgeN-~RVlewI~rR~~g  564 (640)
T KOG3749|consen  524 AKLPKIFHVNWFRKDKEGKFLWPGFGEN-ARVLEWIFRRVAG  564 (640)
T ss_pred             CCCCcEEEeeeeeeccCCCccCCCCcch-hHHHHHHHHHhcc
Confidence            7899999  799988         4555 5799999976554


No 5  
>PHA02503 putative transcription regulator; Provisional
Probab=61.46  E-value=13  Score=20.95  Aligned_cols=22  Identities=36%  Similarity=0.919  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHhhhhcccCCeeeehHHHHH
Q 046225           13 SELEVAKREYLQAAVGISSEKLAIPKLLDW   42 (73)
Q Consensus        13 ~qL~~aa~~Fi~~~v~v~~~~v~lskIf~W   42 (73)
                      ++|..-..+||+++.        +|.+|+|
T Consensus        24 e~l~~~s~~fl~~sl--------ipql~ew   45 (57)
T PHA02503         24 EKLSVYSKDFLQNSL--------IPQLYEW   45 (57)
T ss_pred             HHHHHHHHHHHHhhh--------hHHHHHH
Confidence            455555556665543        5666666


No 6  
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the GTP-dependent group.
Probab=58.44  E-value=2.2  Score=34.18  Aligned_cols=28  Identities=29%  Similarity=0.844  Sum_probs=22.2

Q ss_pred             eehHHH--HHhHhh---------hhcChhHHHHHHHhcCc
Q 046225           35 AIPKLL--DWYLLD---------FAKDFESLLDWICLQSV   63 (73)
Q Consensus        35 ~lskIf--~Wy~~D---------Fg~~~~~ll~~i~~yl~   63 (73)
                      .+||||  .||++|         ||.+ .-+|+||.....
T Consensus       471 ~~PkIF~VNwFrkd~~G~flwpgfgdn-~rvL~Wi~~R~~  509 (579)
T cd00819         471 KLPKIFGVNWFRKDEDGKFLWPGFGEN-SRVLKWIFRRVE  509 (579)
T ss_pred             CCCcEEEEeeeeecCCCCCcCCCccch-hhHHHHHHHHhc
Confidence            699999  899888         4565 469999986643


No 7  
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional
Probab=55.84  E-value=3.1  Score=33.50  Aligned_cols=42  Identities=24%  Similarity=0.627  Sum_probs=27.4

Q ss_pred             HHHhhhhcccCCe-eeehHHH--HHhHhh---------hhcChhHHHHHHHhcCc
Q 046225           21 EYLQAAVGISSEK-LAIPKLL--DWYLLD---------FAKDFESLLDWICLQSV   63 (73)
Q Consensus        21 ~Fi~~~v~v~~~~-v~lskIf--~Wy~~D---------Fg~~~~~ll~~i~~yl~   63 (73)
                      +|+++-..+-++. -.+||||  .||++|         ||.+ ..||+||.....
T Consensus       470 dY~~hwl~~g~~~~~~~PkIF~VNwFrkd~~G~flWPGfgeN-~RVL~Wi~~R~~  523 (601)
T PRK04210        470 DYFQHWLDFGKKLGSKLPKIFGVNWFRKDEDGKFLWPGFGEN-MRVLKWIVDRVE  523 (601)
T ss_pred             HHHHHHHHHhcccCCCCCcEEEeeeeeecCCCCCcCCCCcch-hHHHHHHHHhhc
Confidence            4555533333221 3799999  899997         4555 468999996643


No 8  
>PF04761 Phage_Treg:  Lactococcus bacteriophage putative transcription regulator;  InterPro: IPR006848 This family represents a number of putative transcription repressor proteins found in several Lactococcus bacteriophages. Horizontal transfer may account for the presence of similar proteins in Lactococcus species [].
Probab=49.87  E-value=24  Score=19.86  Aligned_cols=22  Identities=36%  Similarity=0.903  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHhhhhcccCCeeeehHHHHH
Q 046225           13 SELEVAKREYLQAAVGISSEKLAIPKLLDW   42 (73)
Q Consensus        13 ~qL~~aa~~Fi~~~v~v~~~~v~lskIf~W   42 (73)
                      ++|-.-..+||+++        .+|.+|+|
T Consensus        24 ~kl~~~s~~flq~s--------lipql~ew   45 (57)
T PF04761_consen   24 EKLSVDSKDFLQNS--------LIPQLYEW   45 (57)
T ss_pred             HHHHHHHHHHHHHh--------hHHHHHHH
Confidence            34444455555543        36777777


No 9  
>smart00735 ZM ZASP-like motif. Short motif (26 amino acids) present in an alpha-actinin-binding protein, ZASP, and similar molecules.
Probab=48.31  E-value=8  Score=18.32  Aligned_cols=15  Identities=13%  Similarity=0.527  Sum_probs=12.4

Q ss_pred             ceeeechhhHHHHHH
Q 046225            2 KVRVYTASEVESELE   16 (73)
Q Consensus         2 ~vr~Yta~~l~~qL~   16 (73)
                      |+..|+++++++.|.
T Consensus        10 P~glys~~n~~~~l~   24 (26)
T smart00735       10 PIGLYSSENIAETLQ   24 (26)
T ss_pred             CCCCCCcccHHHhhc
Confidence            788999999977664


No 10 
>PF13865 FoP_duplication:  C-terminal duplication domain of Friend of PRMT1
Probab=47.29  E-value=14  Score=21.66  Aligned_cols=12  Identities=42%  Similarity=0.626  Sum_probs=9.2

Q ss_pred             chhhHHHHHHHH
Q 046225            7 TASEVESELEVA   18 (73)
Q Consensus         7 ta~~l~~qL~~a   18 (73)
                      |++.||+||+.-
T Consensus        41 T~EeLDaELD~Y   52 (74)
T PF13865_consen   41 TAEELDAELDAY   52 (74)
T ss_pred             CHHHHHHHHHHH
Confidence            678888888763


No 11 
>PF02865 STAT_int:  STAT protein, protein interaction domain;  InterPro: IPR013799 The STAT protein (Signal Transducers and Activators of Transcription) family contains transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors, hence they act as signal transducers in the cytoplasm and transcription activators in the nucleus []. Binding of these factors to cell-surface receptors leads to receptor autophosphorylation at a tyrosine, the phosphotyrosine being recognised by the STAT SH2 domain, which mediates the recruitment of STAT proteins from the cytosol and their association with the activated receptor. The STAT proteins are then activated by phosphorylation via members of the JAK family of protein kinases, causing them to dimerise and translocated to the nucleus, where they bind to specific promoter sequences in target genes. In mammals, STATs comprise a family of seven structurally and functionally related proteins: Stat1, Stat2, Stat3, Stat4, Stat5a and Stat5b, Stat6. STAT proteins play a critical role in regulating innate and acquired host immune responses. Dysregulation of at least two STAT signalling cascades (i.e. Stat3 and Stat5) is associated with cellular transformation. Signalling through the JAK/STAT pathway is initiated when a cytokine binds to its corresponding receptor. This leads to conformational changes in the cytoplasmic portion of the receptor, initiating activation of receptor associated members of the JAK family of kinases. The JAKs, in turn, mediate phosphorylation at the specific receptor tyrosine residues, which then serve as docking sites for STATs and other signalling molecules. Once recruited to the receptor, STATs also become phosphorylated by JAKs, on a single tyrosine residue. Activated STATs dissociate from the receptor, dimerise, translocate to the nucleus and bind to members of the GAS (gamma activated site) family of enhancers. The seven STAT proteins identified in mammals range in size from 750 and 850 amino acids. The chromosomal distribution of these STATs, as well as the identification of STATs in more primitive eukaryotes, suggest that this family arose from a single primordial gene. STATs share structurally and functionally conserved domains including: an N-terminal domain that strengthens interactions between STAT dimers on adjacent DNA-binding sites; a coiled-coil STAT domain that is implicated in protein-protein interactions; a DNA-binding domain with an immunoglobulin-like fold similar to p53 tumour suppressor protein; an EF-hand-like linker domain connecting the DNA-binding and SH2 domains; an SH2 domain (IPR000980 from INTERPRO) that acts as a phosphorylation-dependent switch to control receptor recognition and DNA-binding; and a C-terminal transactivation domain []. The crystal structure of the N terminus of Stat4 reveals a dimer. The interface of this dimer is formed by a ring-shaped element consisting of five short helices. Several studies suggest that this N-terminal dimerisation promotes cooperativity of binding to tandem GAS elements and with the transcriptional coactivator CBP/p300. This entry represents the N-terminal domain, which is responsible for protein interactions. This domain has a multi-helical structure that can be subdivided into two structural sub-domains.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0004871 signal transducer activity, 0006355 regulation of transcription, DNA-dependent, 0007165 signal transduction; PDB: 1BGF_A 1YVL_A.
Probab=45.73  E-value=24  Score=22.59  Aligned_cols=56  Identities=9%  Similarity=-0.056  Sum_probs=37.2

Q ss_pred             hHHHHHHHHHHHHHhhhhcccCCeeeehHHHHHhHhhhhcChhHHHHHHHhcCcchhh
Q 046225           10 EVESELEVAKREYLQAAVGISSEKLAIPKLLDWYLLDFAKDFESLLDWICLQSVVVTV   67 (73)
Q Consensus        10 ~l~~qL~~aa~~Fi~~~v~v~~~~v~lskIf~Wy~~DFg~~~~~ll~~i~~yl~~~~~   67 (73)
                      ++-++|+..+..+...+.-+  -++.|.++-..+..-|+.++..+...|.++|...+.
T Consensus        62 ~ll~~Lq~~~~~~~~~~~fl--~~~~l~~~~~~~q~~y~~~P~~L~~~I~~~L~~E~~  117 (124)
T PF02865_consen   62 NLLQELQQQASRQSQEDNFL--LQHNLREIAQNFQNRYQQNPLELARIIRNCLQEEKR  117 (124)
T ss_dssp             HHHHHHHHHHHHHHHHT-HH--HHHHHHHHHHHHHHHHCT-HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcCcchhH--HHHHHHHHHHHHHHHhccCHHHHHHHHHHHHHHHHH
Confidence            44556666665555432211  135577788888888999988999999999876554


No 12 
>PRK09885 putative toxin YafO; Provisional
Probab=42.72  E-value=16  Score=24.11  Aligned_cols=39  Identities=15%  Similarity=0.244  Sum_probs=24.6

Q ss_pred             ceeeechhhHHHHHHHHHHHHHhhhhcccCCeeeehHHH
Q 046225            2 KVRVYTASEVESELEVAKREYLQAAVGISSEKLAIPKLL   40 (73)
Q Consensus         2 ~vr~Yta~~l~~qL~~aa~~Fi~~~v~v~~~~v~lskIf   40 (73)
                      .||+|+...|..||..-.-+-|-+.-..=+++-.||.+|
T Consensus         1 ~vrvf~~~~i~~~~~~~~~~~l~~df~~YK~~g~lp~~F   39 (132)
T PRK09885          1 MMRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIF   39 (132)
T ss_pred             CeeeecchhHHHHhCcHHHHHHHHHHHHHHcCCCCchhh
Confidence            489999999999998865555544322213334455443


No 13 
>TIGR03687 pupylate_cterm ubiquitin-like protein Pup. Members of this protein family are Pup, a small protein whose ligation to target proteins steers them toward degradation. This protein family occurs in a number of bacteria, especially Actinobacteria such as Mycobacterium tuberculosis, that possess an archeal-type proteasome. All members of this protein family known during model construction end with the C-terminal motif [FY][VI]QKGG[QE]. Ligation is thought to occur between the C-terminal COOH of Pup and an epsilon-amino group of a Lys on the target protein. The N-terminal half of this protein is poorly conserved and not represented in the seed alignment.
Probab=41.39  E-value=40  Score=17.23  Aligned_cols=19  Identities=26%  Similarity=0.497  Sum_probs=15.5

Q ss_pred             hhHHHHHHHHHHHHHhhhh
Q 046225            9 SEVESELEVAKREYLQAAV   27 (73)
Q Consensus         9 ~~l~~qL~~aa~~Fi~~~v   27 (73)
                      +.|+.-|+..|.+|+++-|
T Consensus        10 DeId~vLe~NAe~FV~~fV   28 (33)
T TIGR03687        10 DEIDGVLESNAEEFVRGFV   28 (33)
T ss_pred             HHHHHHHHHhHHHHHHHHH
Confidence            4678889999999998744


No 14 
>cd03742 SOCS_Rab40 SOCS (suppressors of cytokine signaling) box of Rab40-like proteins. Rab40 is part of the Rab family of small GTP-binding proteins that form the largest family within the Ras superfamily. Rab proteins regulate vesicular trafficking pathways, behaving as membrane-associated molecular switches. Rab40 is characterized by a SOCS box c-terminal to the GTPase domain. The SOCS boxes interact with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=35.84  E-value=60  Score=17.36  Aligned_cols=35  Identities=20%  Similarity=0.197  Sum_probs=27.3

Q ss_pred             HHHHHHHHHhhhhccc-CCeeeehHHHHHhHhhhhc
Q 046225           15 LEVAKREYLQAAVGIS-SEKLAIPKLLDWYLLDFAK   49 (73)
Q Consensus        15 L~~aa~~Fi~~~v~v~-~~~v~lskIf~Wy~~DFg~   49 (73)
                      |+..++.=|+..+.++ =+++-||+-++-|-++|..
T Consensus         6 LQ~LCR~~I~~~t~~~~I~~LPLP~~Lk~yLkey~~   41 (43)
T cd03742           6 LQDLCCRAIVSCTPVYLIDKLPLPVSIKSHLKSFAM   41 (43)
T ss_pred             HHHHHHHHHHHhCCcchhhhCCCCHHHHHHHHhccc
Confidence            6677788888777665 4578999999998888864


No 15 
>PF14502 HTH_41:  Helix-turn-helix domain
Probab=34.54  E-value=30  Score=19.05  Aligned_cols=27  Identities=7%  Similarity=-0.093  Sum_probs=20.0

Q ss_pred             HHHhHhhhhcChhHHHHHHHhcCcchhh
Q 046225           40 LDWYLLDFAKDFESLLDWICLQSVVVTV   67 (73)
Q Consensus        40 f~Wy~~DFg~~~~~ll~~i~~yl~~~~~   67 (73)
                      +.+|+++|+.+ .+.++.-.++|.+.++
T Consensus         9 I~e~~~~~~vs-~GtiQ~Alk~Le~~ga   35 (48)
T PF14502_consen    9 ISEYSEKFGVS-RGTIQNALKFLEENGA   35 (48)
T ss_pred             HHHHHHHhCcc-hhHHHHHHHHHHHCCc
Confidence            57899999987 5677777777665544


No 16 
>TIGR03544 DivI1A_domain DivIVA domain. This model describes a domain found in Bacillus subtilis cell division initiation protein DivIVA, and homologs, toward the N-terminus. It is also found as a repeated domain in certain other proteins, including family TIGR03543.
Probab=34.54  E-value=35  Score=16.87  Aligned_cols=20  Identities=30%  Similarity=0.471  Sum_probs=16.3

Q ss_pred             eeeechhhHHHHHHHHHHHH
Q 046225            3 VRVYTASEVESELEVAKREY   22 (73)
Q Consensus         3 vr~Yta~~l~~qL~~aa~~F   22 (73)
                      .+=|.++.||.-|+..+.++
T Consensus        15 ~rGY~~~eVD~fLd~v~~~~   34 (34)
T TIGR03544        15 LRGYDAAEVDAFLDRVADDL   34 (34)
T ss_pred             CCCCCHHHHHHHHHHHHHhC
Confidence            36699999999999887653


No 17 
>PF14804 Jag_N:  Jag N-terminus; PDB: 3GKU_B.
Probab=33.76  E-value=30  Score=18.98  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=15.3

Q ss_pred             echhhHHHHHHHHHHHHH
Q 046225            6 YTASEVESELEVAKREYL   23 (73)
Q Consensus         6 Yta~~l~~qL~~aa~~Fi   23 (73)
                      |+++++++-++.|+.++=
T Consensus         2 ~~gkt~eeAi~~A~~~l~   19 (52)
T PF14804_consen    2 FEGKTVEEAIEKALKELG   19 (52)
T ss_dssp             EEESSHHHHHHHHHHHTT
T ss_pred             eeECCHHHHHHHHHHHhC
Confidence            678999999999988764


No 18 
>PF05553 DUF761:  Cotton fibre expressed protein;  InterPro: IPR008480 This family consists of several plant proteins of unknown function. Three of the sequences from Gossypium hirsutum (Upland cotton) in this family are described as G. hirsutum fibre expressed proteins []. The remaining sequences, found in Arabidopsis thaliana, are uncharacterised.
Probab=33.40  E-value=40  Score=17.55  Aligned_cols=14  Identities=14%  Similarity=0.468  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHhh
Q 046225           12 ESELEVAKREYLQA   25 (73)
Q Consensus        12 ~~qL~~aa~~Fi~~   25 (73)
                      +.+++.-|.+||+.
T Consensus         2 ~~evd~rAe~FI~~   15 (38)
T PF05553_consen    2 DDEVDRRAEEFIAK   15 (38)
T ss_pred             chHHHHHHHHHHHH
Confidence            46788899999986


No 19 
>PHA00212 putative transcription regulator
Probab=32.77  E-value=72  Score=18.25  Aligned_cols=11  Identities=36%  Similarity=0.558  Sum_probs=4.7

Q ss_pred             HHHHhHhhhhc
Q 046225           39 LLDWYLLDFAK   49 (73)
Q Consensus        39 If~Wy~~DFg~   49 (73)
                      +++=|..||-.
T Consensus        28 ll~~~s~~f~~   38 (63)
T PHA00212         28 LLKDFSVQFIK   38 (63)
T ss_pred             HHHHHHHHHHH
Confidence            33444444433


No 20 
>PRK03430 hypothetical protein; Validated
Probab=31.73  E-value=34  Score=23.04  Aligned_cols=47  Identities=21%  Similarity=0.464  Sum_probs=31.4

Q ss_pred             ceeeechhhHHHHHHHHHHHHHhh--hhc-cc--CCeeeehHHHHHhHhhhhc
Q 046225            2 KVRVYTASEVESELEVAKREYLQA--AVG-IS--SEKLAIPKLLDWYLLDFAK   49 (73)
Q Consensus         2 ~vr~Yta~~l~~qL~~aa~~Fi~~--~v~-v~--~~~v~lskIf~Wy~~DFg~   49 (73)
                      .+|+||++..+ -|+..+|.||.-  ..+ ++  .+++.+-+++.==..+++-
T Consensus        69 s~RIYt~~E~~-~L~~e~rGFL~fLEq~gvL~~~~RE~VIdR~MaL~~~~i~L  120 (157)
T PRK03430         69 SMRIYTPEECE-RLDASCRGFLLFLEQIQVLNLETREMVIDRVMALDTAEFDL  120 (157)
T ss_pred             ceeeeCHHHHH-hCCHHHHHHHHHHHHcCCCCHHHHHHHHHHHHcCCCCCCCH
Confidence            58999999875 488899999865  233 33  5567777776543444444


No 21 
>PF10364 NKWYS:  Putative capsular polysaccharide synthesis protein;  InterPro: IPR018831 This entry contains proteins of no known function. They are found predominantly in Vibrio and cyanobacterial species and are characterised by having a NKWYS sequence motif.
Probab=30.20  E-value=1.6e+02  Score=19.57  Aligned_cols=46  Identities=13%  Similarity=0.203  Sum_probs=31.5

Q ss_pred             eeechhhHHHHHHHHHHHHHh-hhhccc----CCeeeehHHHHHhHhhhhcC
Q 046225            4 RVYTASEVESELEVAKREYLQ-AAVGIS----SEKLAIPKLLDWYLLDFAKD   50 (73)
Q Consensus         4 r~Yta~~l~~qL~~aa~~Fi~-~~v~v~----~~~v~lskIf~Wy~~DFg~~   50 (73)
                      -++--++|++ ++.+.++|++ .++.+.    ...-.=+.|++-|+.-|--.
T Consensus        71 Llir~E~L~~-~~~~i~efL~i~~f~l~~~N~a~nK~Y~~iY~~fke~~~l~  121 (141)
T PF10364_consen   71 LLIRCEKLDS-LQEAIREFLGIDNFTLVNSNEAKNKWYSNIYQEFKESYRLP  121 (141)
T ss_pred             EEEehhhhhh-HHHHHHHHhCCCCccceecccccccchHHHHHHHHHhCCCC
Confidence            3556789999 9999999999 555443    33344555677666666654


No 22 
>COG4574 Eco Serine protease inhibitor ecotin [General function prediction only]
Probab=30.15  E-value=18  Score=24.31  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=10.3

Q ss_pred             CceeeechhhHH
Q 046225            1 MKVRVYTASEVE   12 (73)
Q Consensus         1 ~~vr~Yta~~l~   12 (73)
                      .||-+|+|++|+
T Consensus       133 LPIVVY~P~~Ve  144 (162)
T COG4574         133 LPIVVYTPDNVD  144 (162)
T ss_pred             CCEEEEcCCCce
Confidence            489999999886


No 23 
>cd00059 FH Forkhead (FH), also known as a "winged helix".  FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.
Probab=29.23  E-value=38  Score=19.98  Aligned_cols=18  Identities=17%  Similarity=0.617  Sum_probs=15.6

Q ss_pred             CCeeeehHHHHHhHhhhh
Q 046225           31 SEKLAIPKLLDWYLLDFA   48 (73)
Q Consensus        31 ~~~v~lskIf~Wy~~DFg   48 (73)
                      +++++|+.|++|...-|-
T Consensus        19 ~~~lTL~eIy~~I~~~~p   36 (78)
T cd00059          19 EKRLTLSEIYKWISDNFP   36 (78)
T ss_pred             CCCeeHHHHHHHHHHhCC
Confidence            678999999999988773


No 24 
>PRK11467 secY/secA suppressor protein; Provisional
Probab=28.89  E-value=68  Score=20.75  Aligned_cols=24  Identities=29%  Similarity=0.606  Sum_probs=19.5

Q ss_pred             hhHHHHHHHHHHHHHhhhhcccCC
Q 046225            9 SEVESELEVAKREYLQAAVGISSE   32 (73)
Q Consensus         9 ~~l~~qL~~aa~~Fi~~~v~v~~~   32 (73)
                      .+|++-++.|..+||.++.+++..
T Consensus         5 aTLeeAIdAAREefla~~p~~d~~   28 (124)
T PRK11467          5 ATLEEAIDAAREEFLADNPGIDAE   28 (124)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCCcc
Confidence            368889999999999888777733


No 25 
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=28.86  E-value=54  Score=23.25  Aligned_cols=30  Identities=33%  Similarity=0.388  Sum_probs=26.4

Q ss_pred             CceeeechhhHHHHHHHHHHHHHhhhhccc
Q 046225            1 MKVRVYTASEVESELEVAKREYLQAAVGIS   30 (73)
Q Consensus         1 ~~vr~Yta~~l~~qL~~aa~~Fi~~~v~v~   30 (73)
                      |-|+.|++.++.+-|.....++=.+-+.++
T Consensus         1 M~ik~f~a~~~~eal~~ik~elG~dAvIls   30 (282)
T TIGR03499         1 MKIKRFTAPTMREALAKVKEELGPDAVILS   30 (282)
T ss_pred             CeeEEEecCCHHHHHHHHHHHHCCCcEEEE
Confidence            789999999999999999999988766554


No 26 
>smart00253 SOCS suppressors of cytokine signalling. suppressors of cytokine signalling
Probab=28.52  E-value=95  Score=16.06  Aligned_cols=33  Identities=21%  Similarity=0.249  Sum_probs=23.1

Q ss_pred             HHHHHHHHHhhhhccc-CCeeeehHHHHHhHhhh
Q 046225           15 LEVAKREYLQAAVGIS-SEKLAIPKLLDWYLLDF   47 (73)
Q Consensus        15 L~~aa~~Fi~~~v~v~-~~~v~lskIf~Wy~~DF   47 (73)
                      |...++--|++.++.+ =..+-||..+++|-.+|
T Consensus        10 LqhLCR~~I~~~~~~~~i~~LpLP~~lk~yL~~y   43 (43)
T smart00253       10 LQHLCRFTIRRCTRTDQIKTLPLPPKLKDYLSYY   43 (43)
T ss_pred             HHHHHHHHHHHHcCCcCcccCCCCHHHHHHHHhC
Confidence            4456667777766554 35788999999987654


No 27 
>COG3408 GDB1 Glycogen debranching enzyme [Carbohydrate transport and metabolism]
Probab=28.28  E-value=71  Score=25.88  Aligned_cols=37  Identities=19%  Similarity=0.496  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHhhhhcccC-C---eeeehHHHHHhHhhhhcC
Q 046225           12 ESELEVAKREYLQAAVGISS-E---KLAIPKLLDWYLLDFAKD   50 (73)
Q Consensus        12 ~~qL~~aa~~Fi~~~v~v~~-~---~v~lskIf~Wy~~DFg~~   50 (73)
                      .+-+..|..+.++-...... +   .+-+| |++||. +||-+
T Consensus       248 ~~~~~~a~~dl~~~~~~~~~~g~~~~Ag~P-~~~WF~-~fGRD  288 (641)
T COG3408         248 NEAFRRAKADLLELTTSTGETGPGLYAGLP-IAHWFS-PFGRD  288 (641)
T ss_pred             HHHHHHHHHHHHHHHhhccccCcceEecCC-cchhcc-ccchH
Confidence            35566677777775332221 1   34556 889999 99975


No 28 
>PF00714 IFN-gamma:  Interferon gamma This family is a subset of the SCOP family.;  InterPro: IPR002069 Interferon gamma (IFN-gamma) is produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of microphages and had antiproliferative effects on transformed cells. It can potentiate the antiviral and antitumor effects of the type I interferons. The crystal structures of a number IFN-gamma proteins have been solved, including bovine interferon-gamma at 2.0-A [] and human IFN-gamma at 2.9-A [].; GO: 0005133 interferon-gamma receptor binding, 0006955 immune response, 0005576 extracellular region; PDB: 1FG9_A 1FYH_D 1EKU_B 3BES_L 1RFB_A 1D9G_A 1D9C_B.
Probab=28.21  E-value=40  Score=22.41  Aligned_cols=45  Identities=20%  Similarity=0.375  Sum_probs=28.5

Q ss_pred             eeechhhHHHHHHHHHHHHHhhhhccc-----------------CCeeeehHHHHHhHhhhh
Q 046225            4 RVYTASEVESELEVAKREYLQAAVGIS-----------------SEKLAIPKLLDWYLLDFA   48 (73)
Q Consensus         4 r~Yta~~l~~qL~~aa~~Fi~~~v~v~-----------------~~~v~lskIf~Wy~~DFg   48 (73)
                      .+|+..++.++++.-..-|-.++..|.                 +++|.+|.|+.-|-+=|.
T Consensus         6 ~~y~~~~l~~eIe~LK~yfNas~sdv~dgg~lFl~iLknwkEesekKIi~SqIVs~Y~kiFe   67 (138)
T PF00714_consen    6 GCYCQSNLIKEIEKLKNYFNASNSDVADGGPLFLDILKNWKEESEKKIIQSQIVSFYLKIFE   67 (138)
T ss_dssp             -----HCHHHHHHHHHHHCTTTSCCCCTTS-SSHHHHHHTTTCCCCHHHHHHHHHHHHHHHH
T ss_pred             cccchhhHHHHHHHHHHHhCCCchhhccCCchHHHHHhhhhhccchhhHHHHHHHHHHHHHH
Confidence            479999999999999888865543332                 345777777777776664


No 29 
>PF13984 MsyB:  MsyB protein
Probab=26.92  E-value=73  Score=20.59  Aligned_cols=27  Identities=22%  Similarity=0.497  Sum_probs=20.6

Q ss_pred             hHHHHHHHHHHHHHhhhhcccCCeeee
Q 046225           10 EVESELEVAKREYLQAAVGISSEKLAI   36 (73)
Q Consensus        10 ~l~~qL~~aa~~Fi~~~v~v~~~~v~l   36 (73)
                      +|++-++.|..+||.++-+++.....+
T Consensus         4 TLeEAIdAAREefla~~p~~~ed~~~V   30 (122)
T PF13984_consen    4 TLEEAIDAAREEFLAANPEIDEDEASV   30 (122)
T ss_pred             hHHHHHHHHHHHHHHhCCCccccchhH
Confidence            688999999999999877666333333


No 30 
>PF13531 SBP_bac_11:  Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A ....
Probab=26.92  E-value=75  Score=20.89  Aligned_cols=26  Identities=31%  Similarity=0.500  Sum_probs=21.8

Q ss_pred             eeeechhhHHHHHHHHHHHHHhhhhcc
Q 046225            3 VRVYTASEVESELEVAKREYLQAAVGI   29 (73)
Q Consensus         3 vr~Yta~~l~~qL~~aa~~Fi~~~v~v   29 (73)
                      |++|++..+..-++..+..| ++..++
T Consensus         1 L~V~~~~~~~~~~~~l~~~f-~~~~g~   26 (230)
T PF13531_consen    1 LTVYAASGLAPALEELAEAF-EKQPGI   26 (230)
T ss_dssp             EEEEEEGGGHHHHHHHHHHH-HHHHCE
T ss_pred             CEEEEcccHHHHHHHHHHHH-HhccCC
Confidence            68999999999999999999 654433


No 31 
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]
Probab=26.36  E-value=11  Score=30.30  Aligned_cols=42  Identities=19%  Similarity=0.575  Sum_probs=27.8

Q ss_pred             HHHhhhhccc-CCeeeehHHH--HHhHhh---------hhcChhHHHHHHHhcCc
Q 046225           21 EYLQAAVGIS-SEKLAIPKLL--DWYLLD---------FAKDFESLLDWICLQSV   63 (73)
Q Consensus        21 ~Fi~~~v~v~-~~~v~lskIf--~Wy~~D---------Fg~~~~~ll~~i~~yl~   63 (73)
                      +|+++=...- +..-.+||||  .||++|         ||.+ .-+|+||..-+.
T Consensus       478 dYf~hwl~~G~k~~~k~PKIF~VNwFrr~e~G~Flwpgf~en-~rvL~Wi~~R~e  531 (608)
T COG1274         478 DYFRHWLEFGRKLRDKLPKIFGVNWFRRGEDGRFLWPGFGEN-SRVLKWIVDRIE  531 (608)
T ss_pred             HHHHHHHHHHHhhhccCCcEEEEEeEEEcCCCcEeCCCcccc-hhhhhhHHHHhc
Confidence            5566643332 2212899999  999994         6666 579999986543


No 32 
>PF05028 PARG_cat:  Poly (ADP-ribose) glycohydrolase (PARG);  InterPro: IPR007724 Poly(ADP-ribose) glycohydrolase (PARG) is a ubiquitously expressed exo- and endoglycohydrolase which mediates oxidative and excitotoxic neuronal death [].; GO: 0004649 poly(ADP-ribose) glycohydrolase activity, 0005975 carbohydrate metabolic process; PDB: 4FC2_D 3UEL_C 3UEK_A.
Probab=25.69  E-value=43  Score=24.78  Aligned_cols=56  Identities=23%  Similarity=0.461  Sum_probs=33.9

Q ss_pred             eeeechhhHHHHHHHHHHHHHhhhhcccCCeeeehHHH--HHhHhhhhcChh--HHHHHHHhcC
Q 046225            3 VRVYTASEVESELEVAKREYLQAAVGISSEKLAIPKLL--DWYLLDFAKDFE--SLLDWICLQS   62 (73)
Q Consensus         3 vr~Yta~~l~~qL~~aa~~Fi~~~v~v~~~~v~lskIf--~Wy~~DFg~~~~--~ll~~i~~yl   62 (73)
                      .+=|++++|+.||.+|-..|......-.    ..+.|.  .|=-+.||++..  -||+|++..+
T Consensus       261 ~~Q~~~~~i~REl~Kay~gF~~~~~~~~----~~~~I~TGnWGCGaFgGd~~lK~lIQ~lAas~  320 (340)
T PF05028_consen  261 SRQYKPENIDRELNKAYSGFSSQSEGSQ----NIPPIATGNWGCGAFGGDPQLKFLIQWLAASL  320 (340)
T ss_dssp             CGGGSHHHHHHHHHHHHHHH--TTS-CC----CS--EEEESTTCCCC-B-HHHHHHHHHHHHHH
T ss_pred             hhhhCHHHHHHHHHHHHhhhhccccccc----ccceEecCCcCccccCCCHHHHHHHHHHHHHh
Confidence            4568999999999999999994321111    111122  587888998743  4788887543


No 33 
>PF15368 BioT2:  Spermatogenesis family BioT2
Probab=25.44  E-value=97  Score=21.25  Aligned_cols=27  Identities=22%  Similarity=0.473  Sum_probs=16.9

Q ss_pred             hHHHHHHHHHHHHHhhhhcccCCeeeehHHHHHhHhh
Q 046225           10 EVESELEVAKREYLQAAVGISSEKLAIPKLLDWYLLD   46 (73)
Q Consensus        10 ~l~~qL~~aa~~Fi~~~v~v~~~~v~lskIf~Wy~~D   46 (73)
                      .+-+||++|..+=-|          .|-.+|+||..-
T Consensus       138 ~faaQLEeAvKEE~n----------iLeSLfKWFQ~Q  164 (170)
T PF15368_consen  138 QFAAQLEEAVKEERN----------ILESLFKWFQQQ  164 (170)
T ss_pred             HHHHHHHHHHHHHHH----------HHHHHHHHHHHH
Confidence            345677777665322          355679999763


No 34 
>PF08157 NUC129:  NUC129 domain;  InterPro: IPR012579 This C-terminal domain is found in a novel family of hypothetical nucleolar proteins [].; GO: 0005634 nucleus
Probab=25.00  E-value=1.1e+02  Score=17.69  Aligned_cols=33  Identities=12%  Similarity=0.286  Sum_probs=20.6

Q ss_pred             hHHHHHHHHHHHHHhhhhccc-CCeeeehHHHHH
Q 046225           10 EVESELEVAKREYLQAAVGIS-SEKLAIPKLLDW   42 (73)
Q Consensus        10 ~l~~qL~~aa~~Fi~~~v~v~-~~~v~lskIf~W   42 (73)
                      .+-.-..++|++||++...=- .++-++.++|.-
T Consensus        10 ~l~~~~QqaAk~Fi~~~LYGpgsnRTT~N~flSL   43 (63)
T PF08157_consen   10 SLRDSQQQAAKDFIQSRLYGPGSNRTTVNEFLSL   43 (63)
T ss_pred             hhhhHHHHHHHHHHHHhccCCCCCcccHHHHhhh
Confidence            344455679999999864222 455566666643


No 35 
>PF11834 DUF3354:  Domain of unknown function (DUF3354);  InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement. Inward rectifying potassium (K(+)in) channels play an important role in turgor regulation and ion uptake in higher plants. All of them comprise, from their N-terminal to their C-terminal ends: a short hydrophilic region, a hydrophobic region structurally analogous and partially homologous to the transmembrane domain of voltage-gated animal channels from the Shaker superfamily, a putative cyclic nucleotide-binding domain, and a conserved C-terminal KHA domain. Between these last two regions, some of them (AKT1, AKT2 and SKT1) contain an ankyrin-repeat domain with six repeats homologous to those of human erythrocyte ankyrin.  This entry represents the KHA domain which is unique to plant K(+)in channels. The KHA domain contains two high-homology blocks enriched for hydrophobic and acidic residues, respectively. The KHA domain is essential for interaction of plant K(+)in channels. The KHA domain mediates tetramerization and/or stabilisation of the heteromers [, , ]. 
Probab=24.76  E-value=63  Score=18.80  Aligned_cols=21  Identities=14%  Similarity=0.340  Sum_probs=16.9

Q ss_pred             eechhhHHHHHHHHHHHHHhh
Q 046225            5 VYTASEVESELEVAKREYLQA   25 (73)
Q Consensus         5 ~Yta~~l~~qL~~aa~~Fi~~   25 (73)
                      +.-|+++++.|+.|++.|=-.
T Consensus        22 i~lP~SleeLl~ia~~kfg~~   42 (69)
T PF11834_consen   22 IWLPDSLEELLKIASEKFGFS   42 (69)
T ss_pred             EEcCccHHHHHHHHHHHhCCC
Confidence            345789999999999998654


No 36 
>KOG3467 consensus Histone H4 [Chromatin structure and dynamics]
Probab=24.65  E-value=1.3e+02  Score=18.81  Aligned_cols=35  Identities=6%  Similarity=0.024  Sum_probs=25.8

Q ss_pred             hHHHHHHHHHHHHHhhhhcc----c----CCeeeehHHHHHhH
Q 046225           10 EVESELEVAKREYLQAAVGI----S----SEKLAIPKLLDWYL   44 (73)
Q Consensus        10 ~l~~qL~~aa~~Fi~~~v~v----~----~~~v~lskIf~Wy~   44 (73)
                      -+.+|.+.+++.||++...+    .    .++|+.+-|++-.+
T Consensus        50 ~~yeE~~~~~k~fl~n~i~~A~~yt~HAKRKTvT~~dvv~~LK   92 (103)
T KOG3467|consen   50 LIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALK   92 (103)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHhhhhhceeeHHHHHHHHH
Confidence            46789999999999985432    2    66788888876544


No 37 
>PF13518 HTH_28:  Helix-turn-helix domain
Probab=24.65  E-value=68  Score=16.18  Aligned_cols=22  Identities=14%  Similarity=0.123  Sum_probs=15.2

Q ss_pred             HhhhhcChhHHHHHHHhcCcch
Q 046225           44 LLDFAKDFESLLDWICLQSVVV   65 (73)
Q Consensus        44 ~~DFg~~~~~ll~~i~~yl~~~   65 (73)
                      +..||-+...|-.|+..|-..+
T Consensus        19 a~~~gis~~tv~~w~~~y~~~G   40 (52)
T PF13518_consen   19 AREFGISRSTVYRWIKRYREGG   40 (52)
T ss_pred             HHHHCCCHhHHHHHHHHHHhcC
Confidence            4466666667888888886543


No 38 
>KOG0909 consensus Peptide:N-glycanase [Posttranslational modification, protein turnover, chaperones]
Probab=24.54  E-value=62  Score=25.66  Aligned_cols=35  Identities=29%  Similarity=0.399  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHhh-hhcccCCeeeehHHHHHhHhhh
Q 046225           13 SELEVAKREYLQA-AVGISSEKLAIPKLLDWYLLDF   47 (73)
Q Consensus        13 ~qL~~aa~~Fi~~-~v~v~~~~v~lskIf~Wy~~DF   47 (73)
                      +.-+.|-.++... ...+.++-+..=.|++||+.||
T Consensus       120 EL~~kA~ekla~~eg~ki~kdy~i~leLL~WFKq~F  155 (500)
T KOG0909|consen  120 ELKEKASEKLAKAEGEKIYKDYLIKLELLNWFKQDF  155 (500)
T ss_pred             HHHHHHHHhhcccchhhhhcchHHHHHHHHHHHHhh
Confidence            3334455555542 2222232222237899999996


No 39 
>PRK09946 hypothetical protein; Provisional
Probab=24.53  E-value=78  Score=23.27  Aligned_cols=25  Identities=12%  Similarity=0.361  Sum_probs=17.2

Q ss_pred             ehHHHHHhHhhhh--cChhHHHHHHHh
Q 046225           36 IPKLLDWYLLDFA--KDFESLLDWICL   60 (73)
Q Consensus        36 lskIf~Wy~~DFg--~~~~~ll~~i~~   60 (73)
                      .+.+|.||.+.|-  .+...+++-|..
T Consensus        14 ~~~~yRWFlr~fp~Gg~Y~~v~dALv~   40 (270)
T PRK09946         14 GAVMYRWFLRHFPRGGSYADIHHALIE   40 (270)
T ss_pred             chhHHHHHHHhCCCCCcHHHHHHHHHH
Confidence            4678999999994  445555555543


No 40 
>smart00339 FH FORKHEAD. FORKHEAD, also known as a "winged helix"
Probab=24.14  E-value=54  Score=19.72  Aligned_cols=18  Identities=17%  Similarity=0.610  Sum_probs=15.6

Q ss_pred             CCeeeehHHHHHhHhhhh
Q 046225           31 SEKLAIPKLLDWYLLDFA   48 (73)
Q Consensus        31 ~~~v~lskIf~Wy~~DFg   48 (73)
                      +++++|+.|++|...-|-
T Consensus        19 ~~~ltl~~Iy~~I~~~~p   36 (89)
T smart00339       19 DKRLTLSEIYKWIEDNFP   36 (89)
T ss_pred             CCCeeHHHHHHHHHHhCc
Confidence            678999999999988774


No 41 
>PF00976 ACTH_domain:  Corticotropin ACTH domain;  InterPro: IPR013531 Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin []. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation []. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [, ]. The function of this region is not known, though it is found near the centre of these proteins.
Probab=23.70  E-value=17  Score=19.25  Aligned_cols=12  Identities=42%  Similarity=0.684  Sum_probs=8.3

Q ss_pred             ceeeechhhHHHH
Q 046225            2 KVRVYTASEVESE   14 (73)
Q Consensus         2 ~vr~Yta~~l~~q   14 (73)
                      ||++| |..++++
T Consensus        19 PvKVy-pn~~Eee   30 (39)
T PF00976_consen   19 PVKVY-PNGAEEE   30 (39)
T ss_pred             cceeC-CCCcccc
Confidence            88999 6666543


No 42 
>PF02639 DUF188:  Uncharacterized BCR, YaiI/YqxD family COG1671;  InterPro: IPR003791 This entry describes proteins of unknown function.
Probab=23.56  E-value=51  Score=21.28  Aligned_cols=14  Identities=21%  Similarity=0.491  Sum_probs=12.0

Q ss_pred             eeechhhHHHHHHH
Q 046225            4 RVYTASEVESELEV   17 (73)
Q Consensus         4 r~Yta~~l~~qL~~   17 (73)
                      +.||.+||++.|..
T Consensus        79 ~~yt~~nI~~~L~~   92 (130)
T PF02639_consen   79 KEYTKENIDELLAM   92 (130)
T ss_pred             CCCCHHHHHHHHHH
Confidence            47999999999964


No 43 
>PF03513 Cloacin_immun:  Cloacin immunity protein;  InterPro: IPR003063 The cloacin immunity protein complexes with cloacin in equimolar quantities and inhibits it by binding with high affinity to the cloacin C-terminal catalytic domain. The immunity protein is relatively small, containing 85 amino acids.  An extra ribosome binding site has been found to precede the immunity gene on the polycistronic Clo DF13 mRNA [], which perhaps accounts for the fact that, in cloacinogenic cells, more immunity protein than cloacin is synthesised []. Comparison of the complete amino acid sequence of the Clo DF13 immunity protein with that of the Col E3 and Col E6 immunity proteins reveals extensive similarities in primary structure, although Col E3 and Clo DF13 immunity proteins are exchangeable only to a low extent in vivo and in vitro [].; GO: 0015643 toxin binding, 0030153 bacteriocin immunity; PDB: 1E44_A 2B5U_D 1JCH_D 3EIP_A.
Probab=23.31  E-value=42  Score=20.48  Aligned_cols=16  Identities=25%  Similarity=0.460  Sum_probs=8.3

Q ss_pred             hHhhhhcChhHHHHHHH
Q 046225           43 YLLDFAKDFESLLDWIC   59 (73)
Q Consensus        43 y~~DFg~~~~~ll~~i~   59 (73)
                      |..|||.+ ++||+-+-
T Consensus        21 yS~DlgDd-~svie~lg   36 (82)
T PF03513_consen   21 YSKDLGDD-GSVIEKLG   36 (82)
T ss_dssp             E----TT--THHHHHHT
T ss_pred             echhcCCc-hHHHHHhC
Confidence            67899997 68888664


No 44 
>PF06254 DUF1019:  Protein of unknown function (DUF1019);  InterPro: IPR009364 This entry is represented by Bacteriophage phi-80, CII. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.; PDB: 3C4R_C.
Probab=23.31  E-value=47  Score=20.42  Aligned_cols=13  Identities=23%  Similarity=0.424  Sum_probs=8.2

Q ss_pred             hHHHHHhHhhhhc
Q 046225           37 PKLLDWYLLDFAK   49 (73)
Q Consensus        37 skIf~Wy~~DFg~   49 (73)
                      -+||.|..+|-..
T Consensus        11 Q~iFRwl~~ds~~   23 (89)
T PF06254_consen   11 QKIFRWLDNDSPA   23 (89)
T ss_dssp             HHHHHHHH--SHH
T ss_pred             HHHHHHHhCCCHH
Confidence            3799999997543


No 45 
>smart00070 GLUCA Glucagon like hormones.
Probab=23.11  E-value=1.1e+02  Score=14.74  Aligned_cols=15  Identities=27%  Similarity=0.353  Sum_probs=9.1

Q ss_pred             HHHHHHH-HHHHHHhh
Q 046225           11 VESELEV-AKREYLQA   25 (73)
Q Consensus        11 l~~qL~~-aa~~Fi~~   25 (73)
                      ...-|++ +|++||+.
T Consensus        10 ysk~L~~~~ar~fl~~   25 (27)
T smart00070       10 YSKYLDQLAAKKFLQW   25 (27)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3444544 78888763


No 46 
>cd03739 SOCS_SOCS5 SOCS (suppressors of cytokine signaling) box of SOCS5-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS5 inhibits Th2 differentiation by inhibiting IL-4 signaling. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system.   The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=22.83  E-value=1.5e+02  Score=16.82  Aligned_cols=35  Identities=17%  Similarity=0.340  Sum_probs=26.2

Q ss_pred             HHHHHHHHHhhhhcccC-CeeeehHHHHHhHhhhhc
Q 046225           15 LEVAKREYLQAAVGISS-EKLAIPKLLDWYLLDFAK   49 (73)
Q Consensus        15 L~~aa~~Fi~~~v~v~~-~~v~lskIf~Wy~~DFg~   49 (73)
                      |...+|.=|++..+.+. +.+-||+-++-|-.+|-=
T Consensus         6 LQhLCR~~In~~t~~~~I~~LPLP~~LKdyLkeY~y   41 (57)
T cd03739           6 LQYICRAVICRCTTYDGIDALPLPSMLQDFLKEYHY   41 (57)
T ss_pred             HHHHHHHHHHHhcCCCCcccCcCCHHHHHHHHhCCC
Confidence            56667777887765553 578999999988888753


No 47 
>PF02671 PAH:  Paired amphipathic helix repeat;  InterPro: IPR003822 This family contains the paired amphipathic helix (PAH) repeat. The family contains the eukaryotic Sin3 proteins, which have at least three PAH domains (PAH1, PAH2, and PAH3). Sin3 proteins are components of a co-repressor complex that silences transcription, playing important roles in the transition between proliferation and differentiation. Sin3 proteins are recruited to the DNA by various DNA-binding transcription factors such as the Mad family of repressors, Mnt/Rox, PLZF, MeCP2, p53, REST/NRSF, MNFbeta, Sp1, TGIF and Ume6 []. Sin3 acts as a scaffold protein that in turn recruits histone-binding proteins RbAp46/RbAp48 and histone deacetylases HDAC1/HDAC2, which deacetylate the core histones resulting in a repressed state of the chromatin []. The PAH domains are protein-protein interaction domains through which Sin3 fulfils its role as a scaffold. The PAH2 domain of Sin3 can interact with a wide range of unrelated and structurally diverse transcription factors that bind using different interaction motifs. For example, the Sin3 PAH2 domain can interact with the unrelated Mad and HBP1 factors using alternative interaction motifs that involve binding in opposite helical orientations [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1S5Q_B 2L9S_B 1G1E_B 1S5R_B 2CR7_A 2CZY_A 2LD7_B 2RMR_A 2RMS_A 1PD7_A ....
Probab=21.92  E-value=1.3e+02  Score=15.37  Aligned_cols=32  Identities=6%  Similarity=-0.042  Sum_probs=20.2

Q ss_pred             CCeeeehHHHHHhHhhhhcChhHHHHHHHhcCc
Q 046225           31 SEKLAIPKLLDWYLLDFAKDFESLLDWICLQSV   63 (73)
Q Consensus        31 ~~~v~lskIf~Wy~~DFg~~~~~ll~~i~~yl~   63 (73)
                      ++.+..+.+..--+.=|++. .+|+.+.+.++|
T Consensus        16 ~~~~~~~~v~~~v~~Ll~~h-pdLl~~F~~FlP   47 (47)
T PF02671_consen   16 KGRISRSEVIEEVSELLRGH-PDLLEEFNRFLP   47 (47)
T ss_dssp             CTCSCHHHHHHHHHHHTTT--HHHHHHHHHHSS
T ss_pred             hcCCCHHHHHHHHHHHHccC-HHHHHHHHhhCc
Confidence            44555555665555556665 578888888776


No 48 
>PF12434 Malate_DH:  Malate dehydrogenase enzyme 
Probab=21.92  E-value=1.1e+02  Score=14.98  Aligned_cols=15  Identities=27%  Similarity=0.370  Sum_probs=11.4

Q ss_pred             hhHHHHHHHHHHHHH
Q 046225            9 SEVESELEVAKREYL   23 (73)
Q Consensus         9 ~~l~~qL~~aa~~Fi   23 (73)
                      ++..++|.+||-+|=
T Consensus        11 ~~~r~~lR~AALeYH   25 (28)
T PF12434_consen   11 EDKRAQLRQAALEYH   25 (28)
T ss_pred             HHHHHHHHHHHHHhc
Confidence            556678999988873


No 49 
>PF07812 TfuA:  TfuA-like protein;  InterPro: IPR012924 This domain consists of a group of sequences that are similar to the core of TfuA protein (Q52872 from SWISSPROT). This protein is involved in the production of trifolitoxin (TFX), a gene-encoded, post-translationally modified peptide antibiotic []. The role of TfuA in TFX synthesis is unknown, and it may be involved in other cellular processes []. 
Probab=21.62  E-value=64  Score=20.95  Aligned_cols=17  Identities=12%  Similarity=0.432  Sum_probs=13.7

Q ss_pred             CCeeeehHHHHHhHhhh
Q 046225           31 SEKLAIPKLLDWYLLDF   47 (73)
Q Consensus        31 ~~~v~lskIf~Wy~~DF   47 (73)
                      =|-+-+-+||+||+.--
T Consensus        42 fGM~GvG~If~~Yr~G~   58 (120)
T PF07812_consen   42 FGMIGVGRIFEWYRDGE   58 (120)
T ss_pred             cCCEeehHHHHHHhcCC
Confidence            35688999999999753


No 50 
>PF00123 Hormone_2:  Peptide hormone;  InterPro: IPR000532 A number of polypeptidic hormones, mainly expressed in the intestine or the pancreas, belong to a group of structurally related peptides [, ]. Once such hormone, glucagon is widely distributed and produced in the alpha-cells of pancreatic islets []. It affects glucose metabolism in the liver [] by inhibiting glycogen synthesis, stimulating glycogenolysis and enchancing gluconeogenesis. It also increases mobilisation of glucose, free fatty acids and ketone bodies, which are metabolites produced in excess in diabetes mellitus. Glucagon is produced, like other peptide hormones, as part of a larger precursor (preproglucagon), which is cleaved to produce glucagon, glucagon-like protein I and glucagon-like protein II []. The structure of glucagon itself is fully conserved in all known mammalian species []. Other members of the structurally similar group include glicentin precursor, secretin, gastric inhibitory protein, vasoactive intestinal peptide (VIP), prealbumin, peptide HI-27 and growth hormone releasing factor.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1T5Q_A 2OBU_A 2QKH_B 2L70_A 2L71_A 2B4N_A 1GCN_A 1D0R_A 3IOL_B 2RRI_A ....
Probab=21.51  E-value=78  Score=15.34  Aligned_cols=16  Identities=25%  Similarity=0.387  Sum_probs=10.6

Q ss_pred             hHHHHHHH-HHHHHHhh
Q 046225           10 EVESELEV-AKREYLQA   25 (73)
Q Consensus        10 ~l~~qL~~-aa~~Fi~~   25 (73)
                      ++..-|+. ++++||+.
T Consensus         9 dys~~L~~~aak~fl~~   25 (28)
T PF00123_consen    9 DYSKYLDQLAAKKFLQW   25 (28)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34455555 88999874


No 51 
>PF05112 Baculo_p47:  Baculovirus P47 protein;  InterPro: IPR007799 This family consists of unidentified baculoviral p47 proteins which is one of the primary components of Autographa californica nuclear polyhedrosis virus (AcMNPV) encoded RNA polymerase, which initiates transcription from late and very late promoters []. ; GO: 0046782 regulation of viral transcription
Probab=21.41  E-value=48  Score=24.87  Aligned_cols=31  Identities=32%  Similarity=0.610  Sum_probs=21.2

Q ss_pred             eeeehHHH---HHhHhhhhc--------ChhHHHHHHHhcCc
Q 046225           33 KLAIPKLL---DWYLLDFAK--------DFESLLDWICLQSV   63 (73)
Q Consensus        33 ~v~lskIf---~Wy~~DFg~--------~~~~ll~~i~~yl~   63 (73)
                      ...|=|++   .||++||.-        +...|+.++++.+=
T Consensus        92 d~~llkLl~rDRW~KGD~~RL~~il~~~d~~~Li~F~cN~lW  133 (313)
T PF05112_consen   92 DKRLLKLLLRDRWYKGDFVRLRKILQQPDVSKLIKFACNVLW  133 (313)
T ss_pred             HHHHHHHHHhhccccccHHHHHHHHcccchHHHHHHHHhhhc
Confidence            34444555   799999963        33468889887763


No 52 
>PF12630 Pox_polyA_pol_N:  Poxvirus poly(A) polymerase N-terminal domain;  InterPro: IPR024398 This domain is found at the N terminus of the pox virus Poly(A) polymerase protein [].  Poly(A) polymerase (2.7.7.19 from EC) catalyses template-independent extension of the 3'-end of a DNA or RNA strand by one nucleotide at a time. The Poxvirus enzyme creates the 3'(poly)A tail of mRNAs, and is a heterodimer of a catalytic and a regulatory subunit. This is the catalytic subunit.; PDB: 3ERC_C 3ER8_D 3OWG_A 2GA9_D 2GAF_D 3ER9_B.
Probab=21.25  E-value=94  Score=19.88  Aligned_cols=31  Identities=10%  Similarity=-0.017  Sum_probs=21.8

Q ss_pred             HHHhHhhhhcChhHHHHHHHhcCcchhhhhh
Q 046225           40 LDWYLLDFAKDFESLLDWICLQSVVVTVLYS   70 (73)
Q Consensus        40 f~Wy~~DFg~~~~~ll~~i~~yl~~~~~~~~   70 (73)
                      =+-|-+||++++.++-+.|..|.......++
T Consensus        51 k~~Ff~d~~~s~~eIk~rI~~YFsKQ~~~~k   81 (108)
T PF12630_consen   51 KKRFFSDIESSDSEIKRRILEYFSKQRRTYK   81 (108)
T ss_dssp             HHHH-TTSSS-THHHHHHHHHHTTGGGC---
T ss_pred             HHHHHHhcCCCHHHHHHHHHHHHHhcccHHH
Confidence            3678889998888899999999887665553


No 53 
>PRK09480 slmA division inhibitor protein; Provisional
Probab=21.13  E-value=1.7e+02  Score=18.39  Aligned_cols=45  Identities=11%  Similarity=0.127  Sum_probs=30.7

Q ss_pred             CceeeechhhHHHHHHHHHHHHHhhh----hccc----CCeeeehHHHHHhHh
Q 046225            1 MKVRVYTASEVESELEVAKREYLQAA----VGIS----SEKLAIPKLLDWYLL   45 (73)
Q Consensus         1 ~~vr~Yta~~l~~qL~~aa~~Fi~~~----v~v~----~~~v~lskIf~Wy~~   45 (73)
                      ||.+..+++...+++-.|+.+-+...    +.++    +-.|.-+.|+++|.+
T Consensus         1 ~~~~~~~~~~~r~~Il~aa~~l~~~~~G~~~ti~~Ia~~agvs~gt~Y~~F~~   53 (194)
T PRK09480          1 MAMKRPKKGERREQILQALAQMLESPPGERITTAKLAARVGVSEAALYRHFPS   53 (194)
T ss_pred             CCCcCCCchhHHHHHHHHHHHHHHhcCCCccCHHHHHHHhCCCHhHHHHHCCC
Confidence            78888889999999888877755332    2232    334677778887655


No 54 
>PLN02557 phosphoribosylformylglycinamidine cyclo-ligase
Probab=20.62  E-value=99  Score=23.45  Aligned_cols=29  Identities=10%  Similarity=0.152  Sum_probs=23.2

Q ss_pred             CCeeeehHHHHHhHhhhhcChhHHHHHHH
Q 046225           31 SEKLAIPKLLDWYLLDFAKDFESLLDWIC   59 (73)
Q Consensus        31 ~~~v~lskIf~Wy~~DFg~~~~~ll~~i~   59 (73)
                      .+.+.+|.+|+|..+-++-++.++.+.++
T Consensus       311 ~~~~pv~~~f~~i~~~g~i~~~em~~tfN  339 (379)
T PLN02557        311 TGSWEVPPLFKWLQEAGNIEDAEMRRTFN  339 (379)
T ss_pred             CCCCCCCHHHHHHHHhCCCCHHHHHHhcC
Confidence            67889999999999988887666665554


No 55 
>PF06034 DUF919:  Nucleopolyhedrovirus protein of unknown function (DUF919);  InterPro: IPR009265 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf29. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several short baculovirus proteins of unknown function.
Probab=20.25  E-value=1.5e+02  Score=17.07  Aligned_cols=19  Identities=26%  Similarity=0.543  Sum_probs=16.6

Q ss_pred             hhHHHHHHHHHHHHHhhhh
Q 046225            9 SEVESELEVAKREYLQAAV   27 (73)
Q Consensus         9 ~~l~~qL~~aa~~Fi~~~v   27 (73)
                      .+++..|.....+||+-.|
T Consensus        41 ~~i~~kl~~~R~~FLn~~v   59 (62)
T PF06034_consen   41 QEIEKKLQELRQNFLNFGV   59 (62)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            7889999999999998765


No 56 
>PF00250 Fork_head:  Fork head domain;  InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors []. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [, , ]. The fork head domain binds B-DNA as a monomer [], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2UZK_A 2K86_A 1JXS_A 2C6Y_A 2A3S_A 2D2W_A 2KIU_A 1VTN_C 2A07_J 2AS5_F ....
Probab=20.18  E-value=75  Score=19.30  Aligned_cols=17  Identities=18%  Similarity=0.706  Sum_probs=14.9

Q ss_pred             CCeeeehHHHHHhHhhh
Q 046225           31 SEKLAIPKLLDWYLLDF   47 (73)
Q Consensus        31 ~~~v~lskIf~Wy~~DF   47 (73)
                      .+.++|+.|++|...-|
T Consensus        19 ~~~Ltl~eIy~~i~~~~   35 (96)
T PF00250_consen   19 DKRLTLSEIYEWIEENF   35 (96)
T ss_dssp             TSEBEHHHHHHHHHHHC
T ss_pred             CCCccHHHHHHHHHHhh
Confidence            67899999999987766


No 57 
>PF14998 Ripply:  Transcription Regulator
Probab=20.15  E-value=1.5e+02  Score=18.23  Aligned_cols=27  Identities=22%  Similarity=0.199  Sum_probs=22.8

Q ss_pred             Cceeeechhh-HHHHHHHHHHHHHhh-hh
Q 046225            1 MKVRVYTASE-VESELEVAKREYLQA-AV   27 (73)
Q Consensus         1 ~~vr~Yta~~-l~~qL~~aa~~Fi~~-~v   27 (73)
                      .|||.|-|+. ..+-|-..++.-|.+ +|
T Consensus        42 HPVRL~wPkSk~~dYLy~~gE~lL~nFPV   70 (87)
T PF14998_consen   42 HPVRLYWPKSKCYDYLYSEGEKLLANFPV   70 (87)
T ss_pred             CceEeeccchHHHHHHHHHHHHHHHcCCc
Confidence            3899999988 888899999888887 55


Done!