Citrus Sinensis ID: 046230

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MISIPYLTALTTYFSYGLLFVFGQIRDFFRKIIDWWSANNLQGYAPICLGLEDFYIRRLYLRIQDCFGRPISSAPDAWFDVVERFSNDSNKTLKRTNKVNRCLNLGSYNYLGFAASDEYCTPRVIESLKKYSPSTCSSRVDGGTLMVHNELEECVARFVGKPAAIVFGMGYVTNSAILPVLMRKGSLIISDSLNHNSIVNGARGSGATIRVFQHNTPSHLEEVLREQIAEGQPRTHRPWKKIMVIVEGIYSMEGELCKFPEIIAICKKYKAYIYLDEAHSIGAVGKTGRGVCELLEVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEPRKQMEEEERMKLE
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEECccccccEECcccccEEEEEccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHccccccccccccEEEEcccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccccHHHHHHHHHccEEEEEEccccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccEEcccccccEEEEEEcccccHHHHHHHHHHcccEEEEEEcccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcc
*ISIPYLTALTTYFSYGLLFVFGQIRDFFRKIIDWWSANNLQGYAPICLGLEDFYIRRLYLRIQDCFGRPISSAPDAWFDVVERFSNDSNKTLKRTNKVNRCLNLGSYNYLGFAASDEYCTPRVIESLKKYSPSTCSSRVDGGTLMVHNELEECVARFVGKPAAIVFGMGYVTNSAILPVLMRKGSLIISDSLNHNSIVNGARGSGATIRVFQHNTPSHLEEVLREQIAEGQPRTHRPWKKIMVIVEGIYSMEGELCKFPEIIAICKKYKAYIYLDEAHSIGAVGKTGRGVCELLEVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGED*****AQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISRVGDLVGIKYF*****************
xxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISIPYLTALTTYFSYGLLFVFGQIRDFFRKIIDWWSANNLQGYAPICLGLEDFYIRRLYLRIQDCFGRPISSAPDAWFDVVERFSNDSNKTLKRTNKVNRCLNLGSYNYLGFAASDEYCTPRVIESLKKYSPSTCSSRVDGGTLMVHNELEECVARFVGKPAAIVFGMGYVTNSAILPVLMRKGSLIISDSLNHNSIVNGARGSGATIRVFQHNTPSHLEEVLREQIAEGQPRTHRPWKKIMVIVEGIYSMEGELCKFPEIIAICKKYKAYIYLDEAHSIGAVGKTGRGVCELLEVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEPRKQMEEEERMKLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long chain base biosynthesis protein 2a Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1 constitutes the catalytic core. Involved in the regulation of the programmed cell death (PCD) signaling pathway. Plays an important role during male gametogenesis and embryogenesis.confidentQ9LSZ9
Long chain base biosynthesis protein 2a Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1 constitutes the catalytic core.confidentQ2R3K3
Serine palmitoyltransferase 2 Catalytic subunit of serine palmitoyltransferase (SPT), which catalyzes the committed step in the synthesis of sphingolipids, the condensation of serine with palmitoyl CoA to form the long chain base 3-ketosphinganine.probableQ54EX5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.50Serine C-palmitoyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FC4, chain A
Confidence level:very confident
Coverage over the Query: 66-83,99-469
View the alignment between query and template
View the model in PyMOL
Template: 1C4K, chain A
Confidence level:confident
Coverage over the Query: 39-467
View the alignment between query and template
View the model in PyMOL