Citrus Sinensis ID: 046233

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MASISISCLSRIQVVCRARTRNEPRRSPKSSSKQSNGKVKFRGNSLKAPPQPLAGGEATTYTRLPPKDDLSAVFAAEIKLDDCEVAKLNVKDETKLENEDYISEEDEEEEEEEEEEEEGLGGNLGLSYGQFEIFEGEEGEDEDKYSSENEDGGKIENFDKENGYYEGELEEDVKEKGVPAVMRCFDRAKIFVKAGTGGNGVVAFRREKYVPMGGPSGGDGGRGGNVYVEVDESMNSLLPFRNSVHFRAGRGSHGQGRMQSGAKGQDVVVKVAPGTVIREAGKSKVLLELLVPGQKALLLPGGRGGRGNASFKSGTNKVPRIAENGEEGPEMWLELELKLVADVGIVGAPNAGKSTLLSVISAAQPTIANYPFTTLLPNLGVVSFDYDSTMVVADLPGLLEGAHQGFGLGHEFLRHTERCSALVHVIDGSAEQPEFEFDAVRLELEMFSPEIAEKPYIVAFNKMDLPEAYEKWPSFKEKLQARGIEPFCMSAVKREGTHEVISAAYQLLQKNKEAEERL
cccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHcccccccEEEEEEEEEEEcccccccEEEEcccccccccccccccccccccEEEEEccccccccccccccEEEcccccccccccccccccccEEEEcccccEEEEcccccEEEEcccccCEEEEEccccccccccccccccccccccccccccccEEEEEEEEHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccEEEccccccEEEECcccccccccccccccHHHHcHHHHccEEEEEEEcccccHHHHHHHHHHHHHHccHHHHcccEEEEEEccccccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHcHHHHHcc
*****ISCLSRIQVVCR****************************************ATTYTRLPPKDDLSAVFAAEIKLDDCEVAKLN*****************************GLGGNLGLSYGQFEIFEGEE************DGGKIENFDKEN************EKGVPAVMRCFDRAKIFVKAGTGGNGVVAFRREKYVPMGGPSGGDGGRGGNVYVEVDESMNSLLPFRNSV*********************DVVVKVAPGTVIREAGKSKVLLELLVPGQKALLLPGGRGGRGNASFKSGTNKVPRIAENGEEGPEMWLELELKLVADVGIVGAPNAGKSTLLSVISAAQPTIANYPFTTLLPNLGVVSFDYDSTMVVADLPGLLEGAHQGFGLGHEFLRHTERCSALVHVIDGSAEQPEFEFDAVRLELEMFSPEIAEKPYIVAFNKMDLPEAYEKWPSFKEKLQARGIEPFCMSAVKREGTHEVISAAYQLL**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASISISCLSRIQVVCRARTRNEPRRSPKSSSKQSNGKVKFRGNSLKAPPQPLAGGEATTYTRLPPKDDLSAVFAAEIKLDDCEVAKLNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLGGNLGLSYGQFEIFEGEEGEDEDKYSSENEDGGKIENFDKENGYYEGELEEDVKEKGVPAVMRCFDRAKIFVKAGTGGNGVVAFRREKYVPMGGPSGGDGGRGGNVYVEVDESMNSLLPFRNSVHFRAGRGSHGQGRMQSGAKGQDVVVKVAPGTVIREAGKSKVLLELLVPGQKALLLPGGRGGRGNASFKSGTNKVPRIAENGEEGPEMWLELELKLVADVGIVGAPNAGKSTLLSVISAAQPTIANYPFTTLLPNLGVVSFDYDSTMVVADLPGLLEGAHQGFGLGHEFLRHTERCSALVHVIDGSAEQPEFEFDAVRLELEMFSPEIAEKPYIVAFNKMDLPEAYEKWPSFKEKLQARGIEPFCMSAVKREGTHEVISAAYQLLQKNKEAEERL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTPase obg An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate (By similarity). It may play a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control.probableQ8RBA5
GTPase obg An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate (By similarity). It may play a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control.probableB5YEQ1
GTPase obg An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate (By similarity). It may play a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control.probableA5GD29

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LNZ, chain A
Confidence level:very confident
Coverage over the Query: 184-512
View the alignment between query and template
View the model in PyMOL