BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046251
         (74 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From
           Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis
           State
 pdb|4ANI|C Chain C, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|D Chain D, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|G Chain G, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|H Chain H, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
          Length = 509

 Score = 28.5 bits (62), Expect = 0.92,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 4   IGGSLLVPCVQEWVKNPMLVVPPRYIRPDE 33
           +GGS  +P VQE +K  +   P + + PDE
Sbjct: 309 VGGSTRIPAVQEAIKRELGKEPHKGVNPDE 338


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.139    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,953,963
Number of Sequences: 62578
Number of extensions: 56402
Number of successful extensions: 139
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 138
Number of HSP's gapped (non-prelim): 6
length of query: 74
length of database: 14,973,337
effective HSP length: 44
effective length of query: 30
effective length of database: 12,219,905
effective search space: 366597150
effective search space used: 366597150
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)