Citrus Sinensis ID: 046275


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------
MKAFSLLFLVFSSFISLSLLASASSPNKDLQQLLSFKAALPNPSVLPNWSPNQNPCGFKGVSCKAASVSSIDLSPFTLSVDFHLVASFLLTLDTLETLSLKNSNISGTISLPAGSRCSSFLSSLDLSLNILSGPLSDISYLGSCSSLKVLNLSSNLLDFSGREAGSLKLSLEVLDLSYNKISGANVVPWILFNGCDELKQLALKGNKVTGDINVSKCKNLQFLDVSSNNFSMAVPSFGDCLALEYLDISANKFTGDVGHAISACEHLSFLNVSSNLFSGPIPVGYNEFQGEIPLHLADLCSSLVKLDLSSNNLSGKVPSRFGSCSSLESFDISSNKFSGELPIEIFLSMSNLKELVLSFNDFTGALPDSLSNLTNLETLDLSSNNLSGAIPHNLCQGPRNSLKELFLQNNLLLGSIPSTLSNCSQLVSLHLSFNYLTGTIPSSLGSLSKLQDLKLWLNQLHGEIPPELGNIQTLETLFLDFNELTGTLPAALSNCTNLNWISLSNNHLGGEIPTWIGQLSNLAILKLSNNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLCNNQLTGMIPVMGQFETFQPAKFLNNSGLCGLPLPPCEKDSGASANSRHQKSHRRPASLAGSIAMGLLFSLFCIFGLIIVVVETRKRRKKKESALDVYIDSRSHSGTANTSWKLTGAREALSINLATFEKPLRKLTFADLLEATNGFHNDSLIGSGGFGDVYKAKLKDGSTVAIKKLIHISGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMRYGSLEDVLHNQKKVGIKLNWAARRKIAIGSARGLAFLHHNCIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELSTKP
cccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccEEEccccEEEEEccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccCEEECcccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccccccccccccccccccccccccccccEEEccccCEECcccccccccccccEEEccccccccccccccccccccccccccccccccccccHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccCEECcccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHHHcccccccEEccccccCEEEEEEccccEEEEEEEccccccccHHHHHHHHHHccccccccccEEEEEECcccEEEEEcccccccHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccEEcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHcccccccECccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccccc
*KAFSLLFLVFSSFISLSLLAS****NKDLQQLLSFKAALPNPSVLPNWSPNQNPCGFKGVSCKAASVSSIDLSPFTLSVDFHLVASFLLTLDTLETLSLKNSNISGTISLPAGSRCSSFLSSLDLSLNILSGPLSDISYLGSCSSLKVLNLSSNLLDFSGREAGSLKLSLEVLDLSYNKISGANVVPWILFNGCDELKQLALKGNKVTGDINVSKCKNLQFLDVSSNNFSMAVPSFGDCLALEYLDISANKFTGDVGHAISACEHLSFLNVSSNLFSGPIPVGYNEFQGEIPLHLADLCSSLVKLDLSSNNLSGKVPSRFGSCSSLESFDISSNKFSGELPIEIFLSMSNLKELVLSFNDFTGALPDSLSNLTNLETLDLSSNNLSGAIPHNLCQGPRNSLKELFLQNNLLLGSIPSTLSNCSQLVSLHLSFNYLTGTIPSSLGSLSKLQDLKLWLNQLHGEIPPELGNIQTLETLFLDFNELTGTLPAALSNCTNLNWISLSNNHLGGEIPTWIGQLSNLAILKLSNNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLCNNQLTGMIPVMGQFETFQPAKFLNNSGLCGLPL*************************AGSIAMGLLFSLFCIFGLIIVVVETRKRR*******************************ALSINLATFEKPLRKLTFADLLEATNGFHNDSLIGSGGFGDVYKAKLKDGSTVAIKKLIHISGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMRYGSLEDVLHNQKKVGIKLNWAARRKIAIGSARGLAFLHHNCIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ**************************************
xxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAFSLLFLVFSSFISLSLLASASSPNKDLQQLLSFKAALPNPSVLPNWSPNQNPCGFKGVSCKAASVSSIDLSPFTLSVDFHLVASFLLTLDTLETLSLKNSNISGTISLPAGSRCSSFLSSLDLSLNILSGPLSDISYLGSCSSLKVLNLSSNLLDFSGREAGSLKLSLEVLDLSYNKISGANVVPWILFNGCDELKQLALKGNKVTGDINVSKCKNLQFLDVSSNNFSMAVPSFGDCLALEYLDISANKFTGDVGHAISACEHLSFLNVSSNLFSGPIPVGYNEFQGEIPLHLADLCSSLVKLDLSSNNLSGKVPSRFGSCSSLESFDISSNKFSGELPIEIFLSMSNLKELVLSFNDFTGALPDSLSNLTNLETLDLSSNNLSGAIPHNLCQGPRNSLKELFLQNNLLLGSIPSTLSNCSQLVSLHLSFNYLTGTIPSSLGSLSKLQDLKLWLNQLHGEIPPELGNIQTLETLFLDFNELTGTLPAALSNCTNLNWISLSNNHLGGEIPTWIGQLSNLAILKLSNNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLCNNQLTGMIPVMGQFETFQPAKFLNNSGLCGLPLPPCEKDSGASANSRHQKSHRRPASLAGSIAMGLLFSLFCIFGLIIVVVETRKRRKKKESALDVYIDSRSHSGTANTSWKLTGAREALSINLATFEKPLRKLTFADLLEATNGFHNDSLIGSGGFGDVYKAKLKDGSTVAIKKLIHISGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMRYGSLEDVLHNQKKVGIKLNWAARRKIAIGSARGLAFLHHNCIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELSTKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BRASSINOSTEROID INSENSITIVE 1 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates. Regulates, in response to brassinosteroid binding, a signaling cascade involved in plant development, including expression of light- and stress-regulated genes, promotion of cell elongation, normal leaf and chloroplast senescence, and flowering. Binds brassinolide, and less effectively castasterone, but not 2,3,22,23-O-tetramethylbrassinolide or ecdysone. May be involved in a feedback regulation of brassinosteroid biosynthesis. Phosphorylates BRI1-associated receptor kinase 1 (BAK1), Transthyretin-Like protein (TTL) and SERK1 on 'Ser-299' and 'Thr-462' in vitro. May have a guanylyl cyclase activity.confidentO22476
Systemin receptor SR160 Receptor with a serine/threonine-protein kinase activity. Involved in the perception of systemin, a peptide hormone responsible for the systemic activation of defense genes in leaves of wounded plants. May also regulate, in response to brassinosteroid binding, a signaling cascade involved in plant development.probableQ8L899
Brassinosteroid LRR receptor kinase Receptor with a serine/threonine-protein kinase activity. Regulates, in response to brassinosteroid binding, a signaling cascade involved in plant development, including expression of light- and stress-regulated genes, promotion of cell elongation, normal leaf and chloroplast senescence, and flowering. May be involved in a feedback regulation of brassinosteroid biosynthesis. May be also involved in the perception of systemin, a peptide hormone responsible for the systemic activation of defense genes in leaves of wounded plants.probableQ8GUQ5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.10.-Protein-tyrosine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 123-280,293-563,632-745
View the alignment between query and template
View the model in PyMOL
Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 120-286,300-563,630-726
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 27-136,162-183,215-226,248-564
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 24-756
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 847-1137
View the alignment between query and template
View the model in PyMOL
Template: 3FXX, chain A
Confidence level:confident
Coverage over the Query: 847-1064
View the alignment between query and template
View the model in PyMOL