BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046294
(141 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2J92|A Chain A, 3c Protease From Type A10(61) Foot-And-Mouth Disease
Virus- Crystal Packing Mutant (K51q)
pdb|2J92|B Chain B, 3c Protease From Type A10(61) Foot-And-Mouth Disease
Virus- Crystal Packing Mutant (K51q)
Length = 209
Score = 26.6 bits (57), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 10/37 (27%), Positives = 20/37 (54%)
Query: 4 LNSILLIFCLAIGIIFMSVLQPQHFYGVEYDVRVING 40
L+ + C A G+ + L P+H + +YD +++G
Sbjct: 24 LDGKTVAICCATGVFGTAYLVPRHLFAEQYDKIMLDG 60
>pdb|2WV4|A Chain A, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
Protease In Complex With A Decameric Peptide
Corresponding To The Vp1-2a Cleavage Junction
pdb|2WV4|B Chain B, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
Protease In Complex With A Decameric Peptide
Corresponding To The Vp1-2a Cleavage Junction
pdb|2WV5|A Chain A, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
Protease In Complex With A Decameric Peptide
Corresponding To The Vp1-2a Cleavage Junction With A
Gln To Glu Substitution At P1
pdb|2WV5|B Chain B, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
Protease In Complex With A Decameric Peptide
Corresponding To The Vp1-2a Cleavage Junction With A
Gln To Glu Substitution At P1
pdb|2WV5|C Chain C, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
Protease In Complex With A Decameric Peptide
Corresponding To The Vp1-2a Cleavage Junction With A
Gln To Glu Substitution At P1
pdb|2WV5|D Chain D, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
Protease In Complex With A Decameric Peptide
Corresponding To The Vp1-2a Cleavage Junction With A
Gln To Glu Substitution At P1
Length = 214
Score = 26.2 bits (56), Expect = 6.8, Method: Compositional matrix adjust.
Identities = 10/37 (27%), Positives = 20/37 (54%)
Query: 4 LNSILLIFCLAIGIIFMSVLQPQHFYGVEYDVRVING 40
L+ + C A G+ + L P+H + +YD +++G
Sbjct: 24 LDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIMLDG 60
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.141 0.483
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,661,054
Number of Sequences: 62578
Number of extensions: 184897
Number of successful extensions: 444
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 442
Number of HSP's gapped (non-prelim): 3
length of query: 141
length of database: 14,973,337
effective HSP length: 89
effective length of query: 52
effective length of database: 9,403,895
effective search space: 489002540
effective search space used: 489002540
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 46 (22.3 bits)