BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046294
         (141 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2J92|A Chain A, 3c Protease From Type A10(61) Foot-And-Mouth Disease
          Virus- Crystal Packing Mutant (K51q)
 pdb|2J92|B Chain B, 3c Protease From Type A10(61) Foot-And-Mouth Disease
          Virus- Crystal Packing Mutant (K51q)
          Length = 209

 Score = 26.6 bits (57), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 10/37 (27%), Positives = 20/37 (54%)

Query: 4  LNSILLIFCLAIGIIFMSVLQPQHFYGVEYDVRVING 40
          L+   +  C A G+   + L P+H +  +YD  +++G
Sbjct: 24 LDGKTVAICCATGVFGTAYLVPRHLFAEQYDKIMLDG 60


>pdb|2WV4|A Chain A, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
          Protease In Complex With A Decameric Peptide
          Corresponding To The Vp1-2a Cleavage Junction
 pdb|2WV4|B Chain B, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
          Protease In Complex With A Decameric Peptide
          Corresponding To The Vp1-2a Cleavage Junction
 pdb|2WV5|A Chain A, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
          Protease In Complex With A Decameric Peptide
          Corresponding To The Vp1-2a Cleavage Junction With A
          Gln To Glu Substitution At P1
 pdb|2WV5|B Chain B, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
          Protease In Complex With A Decameric Peptide
          Corresponding To The Vp1-2a Cleavage Junction With A
          Gln To Glu Substitution At P1
 pdb|2WV5|C Chain C, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
          Protease In Complex With A Decameric Peptide
          Corresponding To The Vp1-2a Cleavage Junction With A
          Gln To Glu Substitution At P1
 pdb|2WV5|D Chain D, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
          Protease In Complex With A Decameric Peptide
          Corresponding To The Vp1-2a Cleavage Junction With A
          Gln To Glu Substitution At P1
          Length = 214

 Score = 26.2 bits (56), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 10/37 (27%), Positives = 20/37 (54%)

Query: 4  LNSILLIFCLAIGIIFMSVLQPQHFYGVEYDVRVING 40
          L+   +  C A G+   + L P+H +  +YD  +++G
Sbjct: 24 LDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIMLDG 60


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.141    0.483 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,661,054
Number of Sequences: 62578
Number of extensions: 184897
Number of successful extensions: 444
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 442
Number of HSP's gapped (non-prelim): 3
length of query: 141
length of database: 14,973,337
effective HSP length: 89
effective length of query: 52
effective length of database: 9,403,895
effective search space: 489002540
effective search space used: 489002540
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 46 (22.3 bits)