BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046296
         (167 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IUK|A Chain A, Crystal Structure Of Putative Bacterial Protein Of
          Unknown Function (Duf885, Pf05960.1, ) From
          Arthrobacter Aurescens Tc1, Reveals Fold Similar To
          That Of M32 Carboxypeptidases
 pdb|3IUK|B Chain B, Crystal Structure Of Putative Bacterial Protein Of
          Unknown Function (Duf885, Pf05960.1, ) From
          Arthrobacter Aurescens Tc1, Reveals Fold Similar To
          That Of M32 Carboxypeptidases
          Length = 562

 Score = 26.9 bits (58), Expect = 5.2,   Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%)

Query: 75 DAYNEKMIEANPGNALLLG 93
          DAY EK+IE NP  A  LG
Sbjct: 22 DAYTEKLIELNPSFATTLG 40


>pdb|2WXF|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Pik-39.
 pdb|2WXG|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Sw13.
 pdb|2WXH|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Sw14.
 pdb|2WXI|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-kinase
           P110delta In Complex With Sw30.
 pdb|2WXJ|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Ink654.
 pdb|2WXK|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Ink666.
 pdb|2WXL|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Zstk474.
 pdb|2WXM|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Dl06.
 pdb|2WXN|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-kinase
           P110delta In Complex With Dl07.
 pdb|2WXO|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With As5.
 pdb|2WXP|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Gdc-0941.
 pdb|2WXQ|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With As15.
 pdb|2WXR|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta.
 pdb|2X38|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase
           P110delta In Complex With Ic87114
          Length = 940

 Score = 26.6 bits (57), Expect = 7.2,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 103 RGDFAKAEELCGRAILANPGDGNILSLYADLIWQAHKDASRAESYFDQAV 152
           RG   + E+L  R IL   G G +     DL+W+   +    + +F +A+
Sbjct: 396 RGRITEEEQLQLREILERRGSGELYEHEKDLVWKMRHE---VQEHFPEAL 442


>pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The
           Non-Cognate Hsc70 Peptide Ligand
          Length = 129

 Score = 26.2 bits (56), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 79  EKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAI 117
           +K  E +P N   + N A    E +GD+ K  ELC +AI
Sbjct: 28  DKAKELDPTNMTYITNQAAVYFE-KGDYNKCRELCEKAI 65


>pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex
           With The Hsp90 Peptide Meevd
          Length = 131

 Score = 26.2 bits (56), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 79  EKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAI 117
           +K  E +P N   + N A    E +GD+ K  ELC +AI
Sbjct: 28  DKAKELDPTNMTYITNQAAVYFE-KGDYNKCRELCEKAI 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,185,510
Number of Sequences: 62578
Number of extensions: 113988
Number of successful extensions: 284
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 283
Number of HSP's gapped (non-prelim): 7
length of query: 167
length of database: 14,973,337
effective HSP length: 92
effective length of query: 75
effective length of database: 9,216,161
effective search space: 691212075
effective search space used: 691212075
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)