Query         046317
Match_columns 120
No_of_seqs    14 out of 16
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 10:51:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046317.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046317hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02950 Conotoxin:  Conotoxin;  78.5    0.66 1.4E-05   30.1   0.0   15    4-18      1-15  (75)
  2 PF07172 GRP:  Glycine rich pro  71.6     5.1 0.00011   28.6   3.1   25    1-26      1-25  (95)
  3 PF11153 DUF2931:  Protein of u  48.0      15 0.00033   28.3   2.2   23    4-26      1-23  (216)
  4 PF01456 Mucin:  Mucin-like gly  45.0      17 0.00037   26.0   2.0   16    1-16      1-16  (143)
  5 PRK15188 fimbrial chaperone pr  44.5      36 0.00078   27.4   3.9   44    6-52      7-50  (228)
  6 PF06404 PSK:  Phytosulfokine p  41.7      12 0.00027   26.0   0.8   23   10-32      2-24  (81)
  7 TIGR02052 MerP mercuric transp  40.7      23 0.00049   21.4   1.8   20    4-23      1-20  (92)
  8 PF11912 DUF3430:  Protein of u  35.8      28  0.0006   26.0   1.9   16    4-19      1-17  (212)
  9 PF10868 DUF2667:  Protein of u  33.8      14 0.00031   26.7   0.1   20    1-20      1-20  (90)
 10 PF15240 Pro-rich:  Proline-ric  33.1      28 0.00061   27.9   1.7   11   21-31     14-25  (179)
 11 PF10270 MMgT:  Membrane magnes  31.9      24 0.00052   25.2   1.0   22    7-28      1-22  (106)
 12 PF13956 Ibs_toxin:  Toxin Ibs,  31.1      24 0.00052   19.3   0.7   13    4-16      2-14  (19)
 13 PF11873 DUF3393:  Domain of un  30.0      38 0.00081   27.3   1.9   19    4-22      1-19  (204)
 14 PRK11443 lipoprotein; Provisio  29.4      41 0.00088   25.0   1.9   20    4-23      1-20  (124)
 15 PRK11023 outer membrane lipopr  29.1      40 0.00086   26.0   1.8   17    4-20      4-20  (191)
 16 PF08139 LPAM_1:  Prokaryotic m  26.9      59  0.0013   18.6   1.8   15    5-19      9-23  (25)
 17 COG3683 ABC-type uncharacteriz  26.1      58  0.0013   26.9   2.4   24    4-27      4-27  (213)
 18 COG4037 Predicted membrane pro  25.2      62  0.0013   25.7   2.3   25    4-28     21-47  (163)
 19 PF15330 SIT:  SHP2-interacting  23.9      75  0.0016   23.1   2.4   13    6-18      6-18  (107)
 20 PF09716 ETRAMP:  Malarial earl  23.8      74  0.0016   22.0   2.3   15    4-18      1-15  (84)
 21 PRK14750 kdpF potassium-transp  23.6      92   0.002   18.6   2.3   25    4-28      3-27  (29)
 22 PF14060 DUF4252:  Domain of un  22.5      92   0.002   22.2   2.6   12   42-53     33-44  (155)
 23 PF11587 Prion_bPrPp:  Major pr  22.3      49  0.0011   19.7   0.9   16    1-16      1-16  (29)
 24 PF03896 TRAP_alpha:  Transloco  21.7      73  0.0016   26.8   2.2   18    4-21      1-21  (285)
 25 TIGR01626 ytfJ_HI0045 conserve  21.3   1E+02  0.0022   24.2   2.8   62    9-70      6-73  (184)
 26 PF11777 DUF3316:  Protein of u  21.3      94   0.002   22.1   2.4   10   98-107    91-100 (114)
 27 PF05887 Trypan_PARP:  Procycli  21.0      32  0.0007   26.9   0.0   28    5-32      4-34  (143)
 28 TIGR01843 type_I_hlyD type I s  20.4      95  0.0021   25.0   2.6   19    2-20      2-20  (423)
 29 PRK10318 hypothetical protein;  20.3 1.1E+02  0.0025   23.2   2.8   13    4-16      1-13  (121)
 30 PF06226 DUF1007:  Protein of u  20.3      59  0.0013   25.4   1.3    9   18-26     13-21  (212)

No 1  
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=78.55  E-value=0.66  Score=30.06  Aligned_cols=15  Identities=47%  Similarity=0.687  Sum_probs=0.0

Q ss_pred             chHHHHHHHHHHHHH
Q 046317            4 MRLKSRLIVLFLLMA   18 (120)
Q Consensus         4 ~r~~c~Lillfl~~A   18 (120)
                      ||+.|+|||++|+++
T Consensus         1 mKLt~vliVavLllt   15 (75)
T PF02950_consen    1 MKLTCVLIVAVLLLT   15 (75)
T ss_dssp             ---------------
T ss_pred             CCcchHHHHHHHHHH
Confidence            789999999999887


No 2  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=71.59  E-value=5.1  Score=28.56  Aligned_cols=25  Identities=24%  Similarity=0.147  Sum_probs=11.0

Q ss_pred             CCCchHHHHHHHHHHHHHHhhccccc
Q 046317            1 MAPMRLKSRLIVLFLLMALLSNAHFY   26 (120)
Q Consensus         1 m~~~r~~c~Lillfl~~A~~s~ah~n   26 (120)
                      |+| |.+.+|.|||...-++||+...
T Consensus         1 MaS-K~~llL~l~LA~lLlisSevaa   25 (95)
T PF07172_consen    1 MAS-KAFLLLGLLLAALLLISSEVAA   25 (95)
T ss_pred             Cch-hHHHHHHHHHHHHHHHHhhhhh
Confidence            553 4433443333334444655543


No 3  
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=48.02  E-value=15  Score=28.35  Aligned_cols=23  Identities=26%  Similarity=0.251  Sum_probs=18.0

Q ss_pred             chHHHHHHHHHHHHHHhhccccc
Q 046317            4 MRLKSRLIVLFLLMALLSNAHFY   26 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~s~ah~n   26 (120)
                      ||.+.+|+++|+|.||-++...+
T Consensus         1 mk~i~~l~l~lll~~C~~~~~~~   23 (216)
T PF11153_consen    1 MKKILLLLLLLLLTGCSTNPNEP   23 (216)
T ss_pred             ChHHHHHHHHHHHHhhcCCCccC
Confidence            67777777888889998776665


No 4  
>PF01456 Mucin:  Mucin-like glycoprotein;  InterPro: IPR000458 This family of trypanosomal proteins resemble vertebrate mucins. The protein consists of three regions. The N and C terminii are conserved between all members of the family, whereas the central region is not well conserved and contains a large number of threonine residues which can be glycosylated []. Indirect evidence suggested that these genes might encode the core protein of parasite mucins, glycoproteins that were proposed to be involved in the interaction with, and invasion of, mammalian host cells.
Probab=44.96  E-value=17  Score=26.01  Aligned_cols=16  Identities=44%  Similarity=0.486  Sum_probs=12.8

Q ss_pred             CCCchHHHHHHHHHHH
Q 046317            1 MAPMRLKSRLIVLFLL   16 (120)
Q Consensus         1 m~~~r~~c~Lillfl~   16 (120)
                      |.==|+||-||||-||
T Consensus         1 MmtcRLLCalLvlaLc   16 (143)
T PF01456_consen    1 MMTCRLLCALLVLALC   16 (143)
T ss_pred             CchHHHHHHHHHHHHH
Confidence            4445999999999887


No 5  
>PRK15188 fimbrial chaperone protein BcfB; Provisional
Probab=44.50  E-value=36  Score=27.44  Aligned_cols=44  Identities=25%  Similarity=0.145  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHhhccccchhhhhhccccccceecCceeeEeeee
Q 046317            6 LKSRLIVLFLLMALLSNAHFYQAAEVAGVSRRKGVFNGESVVVVAID   52 (120)
Q Consensus         6 ~~c~Lillfl~~A~~s~ah~n~~a~~~~vs~~k~~~~g~~~~~t~i~   52 (120)
                      ++.+|+||++++++...+   ..+.....+++=++..++..++.+|+
T Consensus         7 ~~~~~~~~l~~a~~~~~~---~~Agi~l~~TRvIy~~~~~~~sv~i~   50 (228)
T PRK15188          7 IFLRLLLLLSAAGLSFAA---QAGGIALGATRVIYPQGSKQTSLPII   50 (228)
T ss_pred             HHHHHHHHHHHHHHHHHh---hcceEEECcEEEEEcCCCceEEEEEE
Confidence            455566655555444332   22333333333333333344444443


No 6  
>PF06404 PSK:  Phytosulfokine precursor protein (PSK);  InterPro: IPR009438 This family consists of several plant specific phytosulfokine precursor proteins. Phytosulfokines, are active as either a pentapeptide or a C-terminally truncated tetrapeptide. These compounds were first isolated because of their ability to stimulate cell division in somatic embryo cultures of Asparagus officinalis [].; GO: 0008083 growth factor activity, 0008283 cell proliferation, 0005576 extracellular region
Probab=41.69  E-value=12  Score=26.03  Aligned_cols=23  Identities=22%  Similarity=0.112  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHhhccccchhhhhh
Q 046317           10 LIVLFLLMALLSNAHFYQAAEVA   32 (120)
Q Consensus        10 Lillfl~~A~~s~ah~n~~a~~~   32 (120)
                      |+|++++++.-+.||+.|.....
T Consensus         2 LLL~~~~~~~~~AARp~p~~~~~   24 (81)
T PF06404_consen    2 LLLLCSSSTSAAAARPLPASQGA   24 (81)
T ss_pred             chHHHHHhhHhhhcCCCCCcccc
Confidence            45556667788999997774433


No 7  
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=40.73  E-value=23  Score=21.38  Aligned_cols=20  Identities=35%  Similarity=0.492  Sum_probs=10.0

Q ss_pred             chHHHHHHHHHHHHHHhhcc
Q 046317            4 MRLKSRLIVLFLLMALLSNA   23 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~s~a   23 (120)
                      ||-+.-|++||++....++|
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~   20 (92)
T TIGR02052         1 MKKLATLLALFVLTSLPAWA   20 (92)
T ss_pred             ChhHHHHHHHHHHhcchhhh
Confidence            34444455555555555554


No 8  
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=35.78  E-value=28  Score=26.03  Aligned_cols=16  Identities=38%  Similarity=0.702  Sum_probs=8.3

Q ss_pred             chHHHHHHHH-HHHHHH
Q 046317            4 MRLKSRLIVL-FLLMAL   19 (120)
Q Consensus         4 ~r~~c~Lill-fl~~A~   19 (120)
                      ||++..|||| +++..+
T Consensus         1 MKll~~lilli~~~~~~   17 (212)
T PF11912_consen    1 MKLLISLILLILLIINF   17 (212)
T ss_pred             CcHHHHHHHHHHHHHhh
Confidence            7885444444 333444


No 9  
>PF10868 DUF2667:  Protein of unknown function (DUF2667);  InterPro: IPR022618  This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana. 
Probab=33.76  E-value=14  Score=26.69  Aligned_cols=20  Identities=20%  Similarity=0.560  Sum_probs=16.9

Q ss_pred             CCCchHHHHHHHHHHHHHHh
Q 046317            1 MAPMRLKSRLIVLFLLMALL   20 (120)
Q Consensus         1 m~~~r~~c~Lillfl~~A~~   20 (120)
                      |.+.|+..+.|++++|++.+
T Consensus         1 m~slk~st~~ilvvvclsiL   20 (90)
T PF10868_consen    1 MGSLKLSTFVILVVVCLSIL   20 (90)
T ss_pred             CCceEEEeeehhHHHHHHHH
Confidence            78888888888888888877


No 10 
>PF15240 Pro-rich:  Proline-rich
Probab=33.12  E-value=28  Score=27.91  Aligned_cols=11  Identities=18%  Similarity=0.042  Sum_probs=5.7

Q ss_pred             hcccc-chhhhh
Q 046317           21 SNAHF-YQAAEV   31 (120)
Q Consensus        21 s~ah~-n~~a~~   31 (120)
                      |||.- +.+.+.
T Consensus        14 SSAQ~~dEdv~~   25 (179)
T PF15240_consen   14 SSAQSTDEDVSQ   25 (179)
T ss_pred             hhcccccccccc
Confidence            77765 444333


No 11 
>PF10270 MMgT:  Membrane magnesium transporter;  InterPro: IPR018937 This entry represents a novel family of membrane magnesium transporters (MMgT) []. The proteins, MMgT1 and MMgT2, are localised to the Golgi complex and post-Golgi vesicles, including the early endosomes, suggesting that they may provide regulated pathways for Mg2+ transport in the Golgi and post-Golgi organelles of epithelium-derived cells []. 
Probab=31.88  E-value=24  Score=25.15  Aligned_cols=22  Identities=23%  Similarity=0.084  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHhhccccchh
Q 046317            7 KSRLIVLFLLMALLSNAHFYQA   28 (120)
Q Consensus         7 ~c~Lillfl~~A~~s~ah~n~~   28 (120)
                      ++++.+|+|+||..|+..+++-
T Consensus         1 l~~iG~llL~HA~YSa~e~~~~   22 (106)
T PF10270_consen    1 LTVIGLLLLLHAGYSAYEHRSL   22 (106)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHH
Confidence            3578899999999887766444


No 12 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=31.06  E-value=24  Score=19.27  Aligned_cols=13  Identities=46%  Similarity=0.728  Sum_probs=8.0

Q ss_pred             chHHHHHHHHHHH
Q 046317            4 MRLKSRLIVLFLL   16 (120)
Q Consensus         4 ~r~~c~Lillfl~   16 (120)
                      ||+...|++|++.
T Consensus         2 Mk~vIIlvvLLli   14 (19)
T PF13956_consen    2 MKLVIILVVLLLI   14 (19)
T ss_pred             ceehHHHHHHHhc
Confidence            5666666666554


No 13 
>PF11873 DUF3393:  Domain of unknown function (DUF3393);  InterPro: IPR024570 Membrane-bound lytic murein transglycosylase C (also known as murein hydrolase C), is a murein-degrading enzyme that may play a role in the recycling of muropeptides during cell elongation and/or cell division. This entry represents the N-terminal domain, whose function is currently not known.
Probab=29.96  E-value=38  Score=27.31  Aligned_cols=19  Identities=21%  Similarity=0.179  Sum_probs=16.0

Q ss_pred             chHHHHHHHHHHHHHHhhc
Q 046317            4 MRLKSRLIVLFLLMALLSN   22 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~s~   22 (120)
                      ||++.+|++++||.+|-+.
T Consensus         1 ~k~l~~~~~~~lL~~Cs~~   19 (204)
T PF11873_consen    1 KKKLLLLLIALLLSGCSSE   19 (204)
T ss_pred             CcCHHHHHHHHHHHHhCCC
Confidence            6788899888889999866


No 14 
>PRK11443 lipoprotein; Provisional
Probab=29.37  E-value=41  Score=25.04  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=16.1

Q ss_pred             chHHHHHHHHHHHHHHhhcc
Q 046317            4 MRLKSRLIVLFLLMALLSNA   23 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~s~a   23 (120)
                      ||.+.++++++||.+|-++.
T Consensus         1 Mk~~~~~~~~~lLsgCa~~~   20 (124)
T PRK11443          1 MKKFIAPLLALLLSGCQIDP   20 (124)
T ss_pred             ChHHHHHHHHHHHHhccCCC
Confidence            67777788888899998865


No 15 
>PRK11023 outer membrane lipoprotein; Provisional
Probab=29.09  E-value=40  Score=26.00  Aligned_cols=17  Identities=18%  Similarity=0.231  Sum_probs=8.1

Q ss_pred             chHHHHHHHHHHHHHHh
Q 046317            4 MRLKSRLIVLFLLMALL   20 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~   20 (120)
                      +.++++|+++|+|.+|.
T Consensus         4 ~~~~~~l~~~~~l~gC~   20 (191)
T PRK11023          4 LSPLAVLLSALLLQGCV   20 (191)
T ss_pred             HHHHHHHHHHHHHhccH
Confidence            33334444444566665


No 16 
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=26.85  E-value=59  Score=18.58  Aligned_cols=15  Identities=27%  Similarity=0.505  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHH
Q 046317            5 RLKSRLIVLFLLMAL   19 (120)
Q Consensus         5 r~~c~Lillfl~~A~   19 (120)
                      |++..++.+|.|.+|
T Consensus         9 kil~~l~a~~~LagC   23 (25)
T PF08139_consen    9 KILFPLLALFMLAGC   23 (25)
T ss_pred             HHHHHHHHHHHHhhc
Confidence            566666666666665


No 17 
>COG3683 ABC-type uncharacterized transport system, periplasmic component [General function prediction only]
Probab=26.10  E-value=58  Score=26.90  Aligned_cols=24  Identities=25%  Similarity=0.336  Sum_probs=17.7

Q ss_pred             chHHHHHHHHHHHHHHhhccccch
Q 046317            4 MRLKSRLIVLFLLMALLSNAHFYQ   27 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~s~ah~n~   27 (120)
                      .+.+.+|++++++.+.+-+||+|-
T Consensus         4 ~~~~~~Ll~~~~~~s~~a~AHPHv   27 (213)
T COG3683           4 TRALIALLILCAIISILAYAHPHV   27 (213)
T ss_pred             HHHHHHHHHHHHhhhhhhhcCCce
Confidence            355667777777788888899874


No 18 
>COG4037 Predicted membrane protein [Function unknown]
Probab=25.22  E-value=62  Score=25.70  Aligned_cols=25  Identities=28%  Similarity=0.287  Sum_probs=18.3

Q ss_pred             chHHHHHHHHHHHHHHh--hccccchh
Q 046317            4 MRLKSRLIVLFLLMALL--SNAHFYQA   28 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~--s~ah~n~~   28 (120)
                      .|++|+++-|++++.++  -+.|.+|-
T Consensus        21 prvf~~~Lal~~l~Gll~ph~lnp~QL   47 (163)
T COG4037          21 PRVFCLLLALLALLGLLCPHSLNPEQL   47 (163)
T ss_pred             HHHHHHHHHHHHHHHhhCccccCHHHc
Confidence            47899999888887777  55665543


No 19 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=23.92  E-value=75  Score=23.10  Aligned_cols=13  Identities=23%  Similarity=0.324  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHHH
Q 046317            6 LKSRLIVLFLLMA   18 (120)
Q Consensus         6 ~~c~Lillfl~~A   18 (120)
                      |+++|+||++.++
T Consensus         6 il~llLll~l~as   18 (107)
T PF15330_consen    6 ILALLLLLSLAAS   18 (107)
T ss_pred             HHHHHHHHHHHHH
Confidence            4556655555533


No 20 
>PF09716 ETRAMP:  Malarial early transcribed membrane protein (ETRAMP);  InterPro: IPR006389 These sequences represent a family of proteins from the malaria parasite Plasmodium falciparum, several of which have been shown to be expressed specifically in the ring stage as well as the rodent parasite Plasmodium yoelii []. A homologue from Plasmodium chabaudi was localized to the parasitophorous vacuole membrane []. Members have an initial hydrophobic, Phe/Tyr-rich stretch long enough to span the membrane, a highly charged region rich in Lys, a second putative transmembrane region, and a second highly charged, low complexity sequence region. Some members have up to 100 residues of additional C-terminal sequence. These genes have been shown to be found in the sub-telomeric regions of both Plasmodium falciparum and P. yoelii chromosomes.
Probab=23.84  E-value=74  Score=21.97  Aligned_cols=15  Identities=20%  Similarity=0.452  Sum_probs=11.0

Q ss_pred             chHHHHHHHHHHHHH
Q 046317            4 MRLKSRLIVLFLLMA   18 (120)
Q Consensus         4 ~r~~c~Lillfl~~A   18 (120)
                      ||+..++.+|.+|++
T Consensus         1 MKi~kv~~ff~~Ll~   15 (84)
T PF09716_consen    1 MKISKVFYFFAFLLA   15 (84)
T ss_pred             CcHHHHHHHHHHHHH
Confidence            778888777777755


No 21 
>PRK14750 kdpF potassium-transporting ATPase subunit F; Provisional
Probab=23.61  E-value=92  Score=18.60  Aligned_cols=25  Identities=20%  Similarity=0.369  Sum_probs=15.8

Q ss_pred             chHHHHHHHHHHHHHHhhccccchh
Q 046317            4 MRLKSRLIVLFLLMALLSNAHFYQA   28 (120)
Q Consensus         4 ~r~~c~Lillfl~~A~~s~ah~n~~   28 (120)
                      ..++|=.+|+++|...+-+|-+|.+
T Consensus         3 ~~vi~g~llv~lLl~YLvYAL~naE   27 (29)
T PRK14750          3 FSIVCGALLVLLLLGYLVYALFNAE   27 (29)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCcc
Confidence            4456666667777777766666543


No 22 
>PF14060 DUF4252:  Domain of unknown function (DUF4252)
Probab=22.46  E-value=92  Score=22.24  Aligned_cols=12  Identities=25%  Similarity=0.401  Sum_probs=6.2

Q ss_pred             cCceeeEeeeee
Q 046317           42 NGESVVVVAIDQ   53 (120)
Q Consensus        42 ~g~~~~~t~i~k   53 (120)
                      +.+..+.+.|++
T Consensus        33 ~~~~~~~v~i~~   44 (155)
T PF14060_consen   33 ENKGVTSVNISK   44 (155)
T ss_pred             CCCCeEEEEECH
Confidence            444455566643


No 23 
>PF11587 Prion_bPrPp:  Major prion protein bPrPp - N terminal; PDB: 1SKH_A.
Probab=22.33  E-value=49  Score=19.73  Aligned_cols=16  Identities=31%  Similarity=0.522  Sum_probs=10.6

Q ss_pred             CCCchHHHHHHHHHHH
Q 046317            1 MAPMRLKSRLIVLFLL   16 (120)
Q Consensus         1 m~~~r~~c~Lillfl~   16 (120)
                      |+-.++.|-|++||+.
T Consensus         1 M~k~~lgcWilvLfva   16 (29)
T PF11587_consen    1 MVKSHLGCWILVLFVA   16 (29)
T ss_dssp             --TTTTTTHHHHHHHH
T ss_pred             CccccccHHHHHHHHH
Confidence            4555688888888875


No 24 
>PF03896 TRAP_alpha:  Translocon-associated protein (TRAP), alpha subunit;  InterPro: IPR005595  The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane [].; GO: 0005783 endoplasmic reticulum
Probab=21.72  E-value=73  Score=26.81  Aligned_cols=18  Identities=67%  Similarity=0.840  Sum_probs=12.5

Q ss_pred             chHHHHHHHHHHH---HHHhh
Q 046317            4 MRLKSRLIVLFLL---MALLS   21 (120)
Q Consensus         4 ~r~~c~Lillfl~---~A~~s   21 (120)
                      ||++..||||+||   .++++
T Consensus         1 ~~~~~~~~ll~ll~~p~~l~~   21 (285)
T PF03896_consen    1 MRFLSRLILLALLVFPATLLS   21 (285)
T ss_pred             CcchhhHHHHHHHHHHHHHHc
Confidence            6788877777776   55553


No 25 
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626. This model represents sequences from gamma proteobacteria that are related to the E. coli protein, YtfJ.
Probab=21.25  E-value=1e+02  Score=24.19  Aligned_cols=62  Identities=24%  Similarity=0.165  Sum_probs=34.6

Q ss_pred             HHHHHHHHHHHhhcccc---chhhhhhccc-cccceecCceeeEeeeeeeeecCchheee--hhhhhh
Q 046317            9 RLIVLFLLMALLSNAHF---YQAAEVAGVS-RRKGVFNGESVVVVAIDQTILAGRKMAVV--KQRCYE   70 (120)
Q Consensus         9 ~Lillfl~~A~~s~ah~---n~~a~~~~vs-~~k~~~~g~~~~~t~i~k~~iggRKm~~~--~~r~~e   70 (120)
                      +|+++++|++....||-   +|..+.-.++ .-..+.++|...-...+...+.|+--++|  -++|.-
T Consensus         6 ~~~~~~~~~~~~~~a~~~~~~~~~p~v~~~~~ge~~~~~~~~~y~~~~~~~l~GKV~lvn~~Aswc~~   73 (184)
T TIGR01626         6 LAAVCGVIFPSSAWAHNLQVEQSVPSVGVSEYGEIVLSGKDTVYQPWGSAELAGKVRVVHHIAGRTSA   73 (184)
T ss_pred             HHHHHHHHhHHHHhhhhhhcCCcCCceEecCCceEEEcCCcccceeccHHHcCCCEEEEEEEecCCCh
Confidence            34444446555555654   5554333333 12234566666677777778888866644  455543


No 26 
>PF11777 DUF3316:  Protein of unknown function (DUF3316);  InterPro: IPR016879 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.25  E-value=94  Score=22.06  Aligned_cols=10  Identities=0%  Similarity=0.122  Sum_probs=5.9

Q ss_pred             CCccceeeec
Q 046317           98 DDKEFVAFSA  107 (120)
Q Consensus        98 ~~~g~vaftA  107 (120)
                      ..+|.+.|.+
T Consensus        91 ~~~G~i~Y~~  100 (114)
T PF11777_consen   91 QADGQINYQY  100 (114)
T ss_pred             ccCCeEEEEe
Confidence            3457666655


No 27 
>PF05887 Trypan_PARP:  Procyclic acidic repetitive protein (PARP);  InterPro: IPR008882 This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of T. brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated [].; GO: 0016020 membrane; PDB: 2X34_B 2X32_B.
Probab=21.00  E-value=32  Score=26.95  Aligned_cols=28  Identities=29%  Similarity=0.227  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHh---hccccchhhhhh
Q 046317            5 RLKSRLIVLFLLMALL---SNAHFYQAAEVA   32 (120)
Q Consensus         5 r~~c~Lillfl~~A~~---s~ah~n~~a~~~   32 (120)
                      |-+|+|-||||..+++   -+|.+.....+.
T Consensus         4 r~l~~LavLL~~A~Lfag~g~AaAadepa~~   34 (143)
T PF05887_consen    4 RHLCLLAVLLFGAALFAGVGSAAAADEPAVR   34 (143)
T ss_dssp             -------------------------------
T ss_pred             ccccccccccccccccccccccccccccccc
Confidence            6678888877774444   444444433333


No 28 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=20.41  E-value=95  Score=24.98  Aligned_cols=19  Identities=26%  Similarity=0.298  Sum_probs=13.2

Q ss_pred             CCchHHHHHHHHHHHHHHh
Q 046317            2 APMRLKSRLIVLFLLMALL   20 (120)
Q Consensus         2 ~~~r~~c~Lillfl~~A~~   20 (120)
                      .++|++|+++++|++.+++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~   20 (423)
T TIGR01843         2 RFARLITWLIAGLVVIFFL   20 (423)
T ss_pred             cchhhHHHHHHHHHHHHHH
Confidence            3578888888877775443


No 29 
>PRK10318 hypothetical protein; Provisional
Probab=20.32  E-value=1.1e+02  Score=23.16  Aligned_cols=13  Identities=23%  Similarity=0.375  Sum_probs=9.1

Q ss_pred             chHHHHHHHHHHH
Q 046317            4 MRLKSRLIVLFLL   16 (120)
Q Consensus         4 ~r~~c~Lillfl~   16 (120)
                      +|++|.|+.|||+
T Consensus         1 ~~~~~~l~~lL~~   13 (121)
T PRK10318          1 KKILCLLITLLFT   13 (121)
T ss_pred             ChhHHHHHHHHHH
Confidence            4677777777666


No 30 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=20.26  E-value=59  Score=25.38  Aligned_cols=9  Identities=22%  Similarity=-0.134  Sum_probs=4.7

Q ss_pred             HHhhccccc
Q 046317           18 ALLSNAHFY   26 (120)
Q Consensus        18 A~~s~ah~n   26 (120)
                      +....||+|
T Consensus        13 ~~~a~AHPH   21 (212)
T PF06226_consen   13 PSPAFAHPH   21 (212)
T ss_pred             ccccccCCc
Confidence            344556654


Done!