Citrus Sinensis ID: 046329


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MQTPAPFAYISSSEGACFEAADEQHQDEDSIVLSLGPPGQRVSKHSTSNQLLARNNNHQNPTSHHSGVTVALHIGPPTTEAAGSTSNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHTVEFGREVEEDEDEDNDFDEEEDE
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHccccc
cccccccEEEEccccccccHHHccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEcccccEEEccccEEEEcccccccHHHHHHHHHcccccccccccccccccccccHcccccEEEccccccccccccccccccHHHHHHHHHHHcccccccccccccccEEEEccHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHcccHHccccccccccccHccccccc
mqtpapfayisssegacfeaadeqhqdedsivlslgppgqrvskhstsnqllarnnnhqnptshhsgvtvalhigpptteaagstsnptpndiVNKLvegqywipspeqilvgptqfscpvcnktfNRYNNMqmhmwghgsqyrkgpeslrgtkAVSSmlrlpcyccaegcknnighprsrplkdfRTLQTHYkrkhgakpfgcrkcgkpfavrgdwrthekncgklwfcicgsdfkhkrslkdhvrsfgdghaphtvefgreveedededndfdeeede
MQTPAPFAYISSSEGACFEAADEQHQDEDSIVLSLGPPGQRVSKHSTSNQLLARNNNHQNPTSHHSGVTVALHIGPPTteaagstsnptPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPCYCCAEGcknnighprsrplKDFRTLQTHykrkhgakpfgcrkcgkPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVrsfgdghaphtvefgreveedededndfdeeede
MQTPAPFAYISSSEGACFEAADEQHQDEDSIVLSLGPPGQRVSKHSTSNQLLARNNNHQNPTSHHSGVTVALHIGPPTTEAAGSTSNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHTVEFGReveedededndfdeeede
********************************************************************************************IVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQY*********TKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKR****************************************
**TPAPFAYISSS***************************************************************************TPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPE****************YCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHTVEFGRE*****************
MQTPAPFAYISSSEGACFEAADEQHQDEDSIVLSLGP**********SNQLLARNNNHQNPTSHHSGVTVALHIGPPT*********PTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHTVEFGR******************
*************EGACFEAADE***DEDSIVLSLGP************************************I*********STSNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKG**********S*MLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHT***G*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTPAPFAYISSSEGACFEAADEQHQDEDSIVLSLGPPGQRVSKHSTSNQLLARNNNHQNPTSHHSGVTVALHIGPPTTEAAGSTSNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHTVEFGREVEEDEDEDNDFDEEEDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.582 0.537 0.756 2e-73
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.510 0.286 0.407 4e-22
Q943I6522 Zinc finger protein STOP1 no no 0.517 0.277 0.411 5e-22
Q2QX40465 Zinc finger protein STAR3 no no 0.521 0.313 0.393 2e-19
Q9FFH3 466 Zinc finger protein NUTCR no no 0.521 0.313 0.349 2e-18
Q700D2 503 Zinc finger protein JACKD no no 0.475 0.264 0.356 3e-18
Q9ZWA6 506 Zinc finger protein MAGPI no no 0.539 0.298 0.343 2e-17
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.285 0.097 0.314 2e-08
O43313 823 ATM interactor OS=Homo sa yes no 0.285 0.097 0.314 2e-08
Q9N003 741 Zinc finger protein 425 ( N/A no 0.628 0.237 0.274 1e-06
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function desciption
 Score =  275 bits (704), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 124/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (0%)

Query: 93  IVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRG 152
           I N+L    YWIP+PEQIL+G T FSC VC KTFNRYNN+QMHMWGHGSQYRKGPESL+G
Sbjct: 121 IENELSGKAYWIPAPEQILIGFTHFSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKG 180

Query: 153 TKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFA 212
           T+   +ML +PCYCC EGC+N+I HPRS+PLKDFRTLQTHYKRKHG KPF CR CGK  A
Sbjct: 181 TQP-RAMLGIPCYCCVEGCRNHIDHPRSKPLKDFRTLQTHYKRKHGHKPFSCRLCGKLLA 239

Query: 213 VRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPH 256
           V+GDWRTHEKNCGK W C+CGSDFKHKRSLKDHV++FG GH P+
Sbjct: 240 VKGDWRTHEKNCGKRWVCVCGSDFKHKRSLKDHVKAFGSGHGPY 283




May act as a transcriptional regulator involved in the differentiation of young endothelium. Altered differentiation results in incompetence for pigments synthesis and the lack of condensed tannins in the seed coat.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q9N003|ZN425_MACFA Zinc finger protein 425 (Fragment) OS=Macaca fascicularis GN=ZNF425 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
297737858275 unnamed protein product [Vitis vinifera] 0.917 0.934 0.770 1e-110
225423901273 PREDICTED: protein TRANSPARENT TESTA 1-l 0.9 0.923 0.776 1e-110
356502472363 PREDICTED: protein TRANSPARENT TESTA 1-l 0.903 0.696 0.657 1e-101
449445258286 PREDICTED: protein TRANSPARENT TESTA 1-l 0.885 0.867 0.698 1e-100
357488357 391 Zinc finger-like protein [Medicago trunc 0.935 0.670 0.665 1e-100
356574641274 PREDICTED: protein TRANSPARENT TESTA 1-l 0.935 0.956 0.656 2e-96
356498326348 PREDICTED: protein TRANSPARENT TESTA 1-l 0.925 0.744 0.654 4e-96
356533917273 PREDICTED: protein TRANSPARENT TESTA 1-l 0.878 0.901 0.689 6e-96
15222242302 C2H2-like zinc finger protein [Arabidops 0.821 0.761 0.730 1e-95
297849714303 zinc finger family protein [Arabidopsis 0.821 0.759 0.726 2e-94
>gi|297737858|emb|CBI27059.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 220/266 (82%), Gaps = 9/266 (3%)

Query: 1   MQTPAPFAYISSSEGACFEAADEQHQDEDSIVLSLGPPGQRVSKHSTSNQLLARNNNHQN 60
           MQTP+ FA ISSSE AC EA +E   DEDSI+LSL PPGQ  SK +  +   ++  N+QN
Sbjct: 1   MQTPS-FACISSSESACLEADEE---DEDSILLSLCPPGQSTSKRAIYHPSSSKPQNYQN 56

Query: 61  PTSHHSGVTVALHIGPPTTEAAGSTSNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCP 120
            T+   GVTVALHIGPP   A  STSNP  N      VEGQYWIPSP QILVGPTQFSC 
Sbjct: 57  -TNREDGVTVALHIGPPN--ACASTSNPN-NINGGDPVEGQYWIPSPAQILVGPTQFSCT 112

Query: 121 VCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPCYCCAEGCKNNIGHPRS 180
           VCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTK  SS+LRLPCYCCA+GCKNNI HPRS
Sbjct: 113 VCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKPASSILRLPCYCCAQGCKNNIEHPRS 172

Query: 181 RPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKR 240
           +PLKDFRTLQTHYKRKHGAKPF CRKCGK FAVRGDWRTHEKNCGKLWFCICGSDFKHKR
Sbjct: 173 KPLKDFRTLQTHYKRKHGAKPFSCRKCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKHKR 232

Query: 241 SLKDHVRSFGDGHAPHTVE-FGREVE 265
           SLKDHVR+FGDGHAPH+VE +G E E
Sbjct: 233 SLKDHVRAFGDGHAPHSVEMYGVEEE 258




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225423901|ref|XP_002278787.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356502472|ref|XP_003520043.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449445258|ref|XP_004140390.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357488357|ref|XP_003614466.1| Zinc finger-like protein [Medicago truncatula] gi|355515801|gb|AES97424.1| Zinc finger-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356574641|ref|XP_003555454.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356498326|ref|XP_003518004.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356533917|ref|XP_003535504.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15222242|ref|NP_172787.1| C2H2-like zinc finger protein [Arabidopsis thaliana] gi|9958064|gb|AAG09553.1|AC011810_12 hypothetical protein, similar to zinc finger proteins [Arabidopsis thaliana] gi|18376496|emb|CAC86166.1| WIP6 protein [Arabidopsis thaliana] gi|332190874|gb|AEE28995.1| C2H2-like zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297849714|ref|XP_002892738.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297338580|gb|EFH68997.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2205334302 DOT5 "DEFECTIVELY ORGANIZED TR 0.821 0.761 0.730 3.7e-96
TAIR|locus:2076641383 NTT "AT3G57670" [Arabidopsis t 0.842 0.616 0.581 3.2e-81
TAIR|locus:2008281337 WIP5 "AT1G51220" [Arabidopsis 0.567 0.471 0.801 3.2e-79
TAIR|locus:2091931412 WIP4 "AT3G20880" [Arabidopsis 0.842 0.572 0.575 3e-78
TAIR|locus:2200003337 WIP3 "AT1G08290" [Arabidopsis 0.589 0.489 0.755 2.1e-75
TAIR|locus:2008386303 TT1 "transparent testa 1" [Ara 0.582 0.537 0.756 2.5e-75
TAIR|locus:2036303499 STOP1 "AT1G34370" [Arabidopsis 0.778 0.436 0.324 2.6e-25
UNIPROTKB|Q943I6522 LOC_Os01g65080 "Zinc finger pr 0.517 0.277 0.411 5.3e-25
TAIR|locus:2172701373 AT5G22890 [Arabidopsis thalian 0.603 0.453 0.368 6.8e-24
UNIPROTKB|Q2QX40465 STAR3 "Zinc finger protein STA 0.514 0.309 0.407 8.7e-24
TAIR|locus:2205334 DOT5 "DEFECTIVELY ORGANIZED TRIBUTARIES 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 956 (341.6 bits), Expect = 3.7e-96, P = 3.7e-96
 Identities = 171/234 (73%), Positives = 193/234 (82%)

Query:    27 DEDSIVLSLGPPGQRVSKHSTSNQLLARNNNHQN-PTSHHSGVTVALHIGPPTTEAAGST 85
             DEDS+VLSLGPPGQ+   H+        +++  N P ++ +GVTVALHIGPP+++    +
Sbjct:    12 DEDSVVLSLGPPGQQYPSHNKPTSTKPSSDHEFNHPLTNPNGVTVALHIGPPSSDKETLS 71

Query:    86 SNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRK 145
                    +  +  +GQYWIPS  QILVGPTQFSC VCNKTFNR+NNMQMHMWGHGSQYRK
Sbjct:    72 GGNNQEGLTAR--QGQYWIPSLSQILVGPTQFSCSVCNKTFNRFNNMQMHMWGHGSQYRK 129

Query:   146 GPESLRGTKAVSSMLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCR 205
             GPESLRGTK+ SS+LRLPCYCCAEGCKNNI HPRS+PLKDFRTLQTHYKRKHGAKPF CR
Sbjct:   130 GPESLRGTKSSSSILRLPCYCCAEGCKNNIDHPRSKPLKDFRTLQTHYKRKHGAKPFRCR 189

Query:   206 K-CGKPFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRSFGDGHAPHTV 258
             K C K FAVRGDWRTHEKNCGKLWFC+CGSDFKHKRSLKDHVR+FGDGHA HTV
Sbjct:   190 KKCEKTFAVRGDWRTHEKNCGKLWFCVCGSDFKHKRSLKDHVRAFGDGHAAHTV 243




GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0010305 "leaf vascular tissue pattern formation" evidence=IMP
GO:0010588 "cotyledon vascular tissue pattern formation" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0048367 "shoot system development" evidence=IMP
TAIR|locus:2076641 NTT "AT3G57670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008281 WIP5 "AT1G51220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091931 WIP4 "AT3G20880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200003 WIP3 "AT1G08290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008386 TT1 "transparent testa 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036303 STOP1 "AT1G34370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q943I6 LOC_Os01g65080 "Zinc finger protein STOP1 homolog" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2172701 AT5G22890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QX40 STAR3 "Zinc finger protein STAR3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00030295001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (275 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.97
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.95
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.88
KOG3576267 consensus Ovo and related transcription factors [T 99.82
KOG3608467 consensus Zn finger proteins [General function pre 99.81
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.75
KOG3608 467 consensus Zn finger proteins [General function pre 99.72
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.59
KOG3576267 consensus Ovo and related transcription factors [T 99.57
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.54
PLN03086567 PRLI-interacting factor K; Provisional 99.34
PLN03086567 PRLI-interacting factor K; Provisional 99.31
PHA00733128 hypothetical protein 99.28
PHA0276855 hypothetical protein; Provisional 99.08
PHA0276855 hypothetical protein; Provisional 99.01
KOG3993500 consensus Transcription factor (contains Zn finger 98.96
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.91
PHA00733128 hypothetical protein 98.78
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.58
PHA0073279 hypothetical protein 98.54
PHA0061644 hypothetical protein 98.48
KOG3993500 consensus Transcription factor (contains Zn finger 98.44
PHA0061644 hypothetical protein 98.25
PHA0073279 hypothetical protein 98.06
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.94
COG5189423 SFP1 Putative transcriptional repressor regulating 97.87
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.86
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.78
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.75
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.72
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.67
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.48
COG5189423 SFP1 Putative transcriptional repressor regulating 97.18
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.15
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.13
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.13
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.89
smart0035526 ZnF_C2H2 zinc finger. 96.87
PRK04860160 hypothetical protein; Provisional 96.84
PRK04860160 hypothetical protein; Provisional 96.67
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.51
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.44
KOG1146 1406 consensus Homeobox protein [General function predi 96.38
COG5048467 FOG: Zn-finger [General function prediction only] 96.33
smart0035526 ZnF_C2H2 zinc finger. 96.32
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.05
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.02
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.85
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.69
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 95.64
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.36
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.35
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.56
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.66
KOG1146 1406 consensus Homeobox protein [General function predi 93.55
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.54
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 93.53
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.81
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.72
KOG2893 341 consensus Zn finger protein [General function pred 92.52
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 92.47
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.17
KOG2893 341 consensus Zn finger protein [General function pred 91.66
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.46
KOG2186 276 consensus Cell growth-regulating nucleolar protein 90.44
COG5048467 FOG: Zn-finger [General function prediction only] 89.77
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 89.23
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 88.65
KOG2186 276 consensus Cell growth-regulating nucleolar protein 87.87
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 87.12
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 86.84
COG404965 Uncharacterized protein containing archaeal-type C 86.73
KOG2071579 consensus mRNA cleavage and polyadenylation factor 85.17
PRK0967872 DNA-binding transcriptional regulator; Provisional 84.2
COG5236 493 Uncharacterized conserved protein, contains RING Z 84.19
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 83.36
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 83.16
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 83.05
PF1526954 zf-C2H2_7: Zinc-finger 82.95
COG404965 Uncharacterized protein containing archaeal-type C 82.73
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 80.42
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 80.41
PHA0062659 hypothetical protein 80.38
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.97  E-value=8.2e-31  Score=208.38  Aligned_cols=135  Identities=28%  Similarity=0.479  Sum_probs=122.6

Q ss_pred             CCCCCCCcccccccccccccCCCCchhhccC---CCccccccccccccccchHHHhHhhhCCCCCCCCccccccccccCC
Q 046329           83 GSTSNPTPNDIVNKLVEGQYWIPSPEQILVG---PTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSM  159 (280)
Q Consensus        83 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~---~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~  159 (280)
                      ......|.|..|++.+.+...|.+|.++|..   .+.+.|.+|+|.|.....|.+|+++|+                   
T Consensus       125 ~~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-------------------  185 (279)
T KOG2462|consen  125 AAKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-------------------  185 (279)
T ss_pred             cccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-------------------
Confidence            3355678999999999999999999998865   677899999999999999999999994                   


Q ss_pred             CccccCCCcCCccCCCCCCCCCCCCChHHHHHHHHHhhCCCCeeCCCCCcccccchhhhHhhhcc--Ccceee-ccCccc
Q 046329          160 LRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNC--GKLWFC-ICGSDF  236 (280)
Q Consensus       160 ~~~~C~~C~~~~~~~~~~~~~k~f~~~~~L~~H~~~h~~ekp~~C~~C~k~F~~~~~L~~H~~~~--~k~~~C-~C~k~F  236 (280)
                      .+++|.+|||.            |...+.|+.|+|+|+|||||.|..|+|+|..+++|+.||.||  .|.|+| .|+|+|
T Consensus       186 l~c~C~iCGKa------------FSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  186 LPCECGICGKA------------FSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSF  253 (279)
T ss_pred             CCccccccccc------------ccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHH
Confidence            57899999987            999999999999999999999999999999999999999986  599999 999999


Q ss_pred             CChhhHHHHHHH
Q 046329          237 KHKRSLKDHVRS  248 (280)
Q Consensus       237 ~~~~~L~~H~r~  248 (280)
                      ..++.|.+|...
T Consensus       254 sl~SyLnKH~ES  265 (279)
T KOG2462|consen  254 ALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHhhhh
Confidence            999999999876



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification] Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 35/143 (24%), Positives = 56/143 (39%), Gaps = 34/143 (23%) Query: 110 ILVGPTQFSCPVCNKTFNRYNNMQMHMWGH-GSQYRKGPESLRGTKAVSSMLRLPCYCCA 168 + G ++CP C K+F+R +++ H H G + K PE Sbjct: 15 LEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPEC------------------- 55 Query: 169 EGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEK--NCGK 226 + D + L H + G KP+ C +CGK F+ R + R H++ K Sbjct: 56 -----------GKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEK 104 Query: 227 LWFC-ICGSDFKHKRSLKDHVRS 248 + C CG F L+ H R+ Sbjct: 105 PYACPECGKSFSQLAHLRAHQRT 127

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 42.1 bits (100), Expect = 8e-06
 Identities = 17/76 (22%), Positives = 25/76 (32%), Gaps = 7/76 (9%)

Query: 188 TLQTHYKRKH-GAKPFGCRKCGKPFAVRGDWRTHEKN----CGKLWFC-ICGSDFKHKRS 241
           +  +   R H G KP+ C  C   F   G  + H           + C  C +    K  
Sbjct: 2   SSGSS-GRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSD 60

Query: 242 LKDHVRSFGDGHAPHT 257
           L  H+R       P +
Sbjct: 61  LGVHLRKQHSYSGPSS 76


>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.98
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.71
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.7
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.66
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.65
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.61
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.61
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.6
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.54
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.49
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.48
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.48
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.48
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.44
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.43
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.42
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.41
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.41
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.37
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.36
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.36
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.32
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.31
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.26
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.25
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.17
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.1
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.01
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.01
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.0
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.93
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.93
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.92
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.91
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.9
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.9
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.89
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.88
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.88
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.87
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.82
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.82
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.8
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.78
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.75
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.75
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.74
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.72
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.72
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.71
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.71
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.64
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.61
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.61
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.6
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.56
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.53
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.49
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.45
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.4
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.4
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.36
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.36
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.3
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.28
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.28
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.28
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.27
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.25
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.24
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.24
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.53
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.21
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.19
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.18
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.49
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.16
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.16
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.15
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.15
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.13
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.12
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.4
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.11
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.06
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.03
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.01
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.0
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.0
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.25
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.99
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.98
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.97
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.97
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.96
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.95
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.89
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.86
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.03
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.99
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.77
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.68
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.6
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.57
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.54
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.87
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.85
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.75
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.17
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.95
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.48
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.95
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.63
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.61
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.2
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 90.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.51
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.54
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 87.33
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 86.1
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 85.7
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 85.41
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.8
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 84.48
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.74
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 83.01
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.98  E-value=1.6e-33  Score=223.68  Aligned_cols=156  Identities=22%  Similarity=0.482  Sum_probs=131.8

Q ss_pred             CCCCCcccccccccccccCCCCchhhccCCCccccccccccccccchHHHhHhhhCCCCCCCCccccccccccCCCcccc
Q 046329           85 TSNPTPNDIVNKLVEGQYWIPSPEQILVGPTQFSCPVCNKTFNRYNNMQMHMWGHGSQYRKGPESLRGTKAVSSMLRLPC  164 (280)
Q Consensus        85 ~~~~~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~C  164 (280)
                      ..++|.|..|++.|.....|..|+++|.++++|.|..|++.|.....|..|++.|                 .++++|.|
T Consensus        18 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h-----------------~~~~~~~C   80 (190)
T 2i13_A           18 GEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTH-----------------TGEKPYKC   80 (190)
T ss_dssp             -------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHH-----------------HCCCCEEC
T ss_pred             CCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhc-----------------CCCCCccC
Confidence            4578999999999999999999999999999999999999999999999999999                 44478999


Q ss_pred             CCCcCCccCCCCCCCCCCCCChHHHHHHHHHhhCCCCeeCCCCCcccccchhhhHhhhc--cCcceee-ccCcccCChhh
Q 046329          165 YCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKN--CGKLWFC-ICGSDFKHKRS  241 (280)
Q Consensus       165 ~~C~~~~~~~~~~~~~k~f~~~~~L~~H~~~h~~ekp~~C~~C~k~F~~~~~L~~H~~~--~~k~~~C-~C~k~F~~~~~  241 (280)
                      ..|++.            |.....|..|+++|.++++|.|.+|++.|.....|..|+++  ++++|.| .|++.|.+...
T Consensus        81 ~~C~~~------------f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  148 (190)
T 2i13_A           81 PECGKS------------FSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDN  148 (190)
T ss_dssp             TTTCCE------------ESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHH
T ss_pred             cccCCc------------cCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHH
Confidence            999988            99999999999999999999999999999999999999995  5799999 99999999999


Q ss_pred             HHHHHHHhCCCCCCccccCCCcccccccc
Q 046329          242 LKDHVRSFGDGHAPHTVEFGREVEEDEDE  270 (280)
Q Consensus       242 L~~H~r~~h~~~~~~~C~~C~~~~~~~~~  270 (280)
                      |..|+++ |.++++|.|++|++.|.....
T Consensus       149 L~~H~~~-H~~~~~~~C~~C~~~f~~~~~  176 (190)
T 2i13_A          149 LHTHQRT-HTGEKPYKCPECGKSFSRRDA  176 (190)
T ss_dssp             HHHHHHH-HHCCCCEECTTTCCEESSHHH
T ss_pred             HHHHHHh-cCCCCCeECCCCCCccCCHHH
Confidence            9999999 788999999999999987543



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.8 bits (82), Expect = 3e-04
 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 4/51 (7%)

Query: 200 KPFGCRKCGKPFAVRGDWRTHEKNCGKLWFC---ICGSDFKHKRSLKDHVR 247
           K + C +CGK F  +     H      L      +CG  FK K  L  H++
Sbjct: 2   KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK 51


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.64
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.61
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.23
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.17
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.11
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.1
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.1
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.08
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.08
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.06
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.03
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.02
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.01
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.0
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.0
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.99
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.95
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.93
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.87
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.87
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.85
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.76
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.7
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.54
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.53
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.52
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.46
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.45
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.42
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.42
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.35
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.25
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.25
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.12
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.09
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.99
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.99
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.83
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.83
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.74
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.69
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.66
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.62
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.58
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.51
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.49
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.46
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.45
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.38
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.36
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.35
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.24
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.23
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.22
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.21
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.19
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.14
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.14
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.92
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.91
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.85
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.85
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.83
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.81
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.76
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.72
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.67
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.67
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.58
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.46
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.31
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.15
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.12
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.03
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.87
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.81
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.7
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.59
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.53
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.47
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.31
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.84
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.7
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.53
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.08
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.9
d1y0jb136 U-shaped transcription factor, different fingers { 92.86
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.64
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.3
d1y0jb136 U-shaped transcription factor, different fingers { 91.94
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.9
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.73
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 90.72
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.25
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.73
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.66
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 88.53
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.37
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 88.27
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 87.93
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.93
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.81
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 87.15
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.6
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 86.57
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.54
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.22
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 86.11
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.68
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.64  E-value=5.8e-17  Score=98.42  Aligned_cols=53  Identities=26%  Similarity=0.564  Sum_probs=38.2

Q ss_pred             CCccccCCCcCCccCCCCCCCCCCCCChHHHHHHHHHhhCCCCeeCCCCCcccccchhhhHhhhcc
Q 046329          159 MLRLPCYCCAEGCKNNIGHPRSRPLKDFRTLQTHYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNC  224 (280)
Q Consensus       159 ~~~~~C~~C~~~~~~~~~~~~~k~f~~~~~L~~H~~~h~~ekp~~C~~C~k~F~~~~~L~~H~~~~  224 (280)
                      +++|+| .||+.            |.....|..|+++|+|++||.|.+||++|.+.+.|.+|+++|
T Consensus         1 EK~y~C-~Cgk~------------F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKS------------FTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCE------------ESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCe------------ECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            356777 47766            777777777777777777777777777777777777777653



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure