BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046351
(468 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BLE|A Chain A, Crystal Structure Of The Catalytic Domain Of Licms In
Complexed With Malonate
pdb|3BLF|A Chain A, Crystal Structure Of The Catalytic Domain Of Licms In
Complexed With Pyruvate
pdb|3BLI|A Chain A, Crystal Structure Of The Catalytic Domain Of Licms In
Complexed With Pyruvate And Acetyl-Coa
Length = 337
Score = 28.9 bits (63), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 19/33 (57%)
Query: 400 YPSLHFEACYYQAIEAAIELSLSAVEAGAQGEH 432
YP +HFE + + ++ SL A+ AG +G H
Sbjct: 211 YPDIHFEFHGHNDYDLSVANSLQAIRAGVKGLH 243
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.136 0.426
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,179,529
Number of Sequences: 62578
Number of extensions: 597318
Number of successful extensions: 1227
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1226
Number of HSP's gapped (non-prelim): 1
length of query: 468
length of database: 14,973,337
effective HSP length: 102
effective length of query: 366
effective length of database: 8,590,381
effective search space: 3144079446
effective search space used: 3144079446
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)