BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046359
         (103 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CZQ|A Chain A, Crystal Structure Of Putative Polyphosphate Kinase 2 From
           Sinorhizobium Meliloti
 pdb|3CZQ|B Chain B, Crystal Structure Of Putative Polyphosphate Kinase 2 From
           Sinorhizobium Meliloti
 pdb|3CZQ|C Chain C, Crystal Structure Of Putative Polyphosphate Kinase 2 From
           Sinorhizobium Meliloti
 pdb|3CZQ|D Chain D, Crystal Structure Of Putative Polyphosphate Kinase 2 From
           Sinorhizobium Meliloti
          Length = 304

 Score = 28.1 bits (61), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 8/49 (16%)

Query: 47  NGNVGVDGMISVIAHELAELSTNPLVNAWYAGEDPTEIGDLCEGLYGSG 95
            GN      I+VI H L +L         Y G+D   IG++ E + GSG
Sbjct: 257 RGNDKRRSRINVIRHXLTKLD--------YDGKDEAAIGEVDEKILGSG 297


>pdb|3CVG|A Chain A, Crystal Structure Of A Periplasmic Putative Metal
          Binding Protein
 pdb|3CVG|B Chain B, Crystal Structure Of A Periplasmic Putative Metal
          Binding Protein
 pdb|3CVG|C Chain C, Crystal Structure Of A Periplasmic Putative Metal
          Binding Protein
 pdb|3CVG|D Chain D, Crystal Structure Of A Periplasmic Putative Metal
          Binding Protein
          Length = 294

 Score = 26.9 bits (58), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 26/67 (38%), Gaps = 4/67 (5%)

Query: 33 GYMGGGGPAALKPPNGNVGVDGMISVIAHELAELSTN----PLVNAWYAGEDPTEIGDLC 88
          GY     P  L+  NG  G  G++  +A    +   +    P   AWY  +    I  L 
Sbjct: 12 GYGSKHSPVQLRIGNGGAGQSGLVKELADAFIKSKVDSGSAPFKVAWYKSDTTVTINYLK 71

Query: 89 EGLYGSG 95
          +G+   G
Sbjct: 72 DGIVDVG 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.140    0.439 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,831,932
Number of Sequences: 62578
Number of extensions: 155822
Number of successful extensions: 214
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 187
Number of HSP's gapped (non-prelim): 30
length of query: 103
length of database: 14,973,337
effective HSP length: 68
effective length of query: 35
effective length of database: 10,718,033
effective search space: 375131155
effective search space used: 375131155
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)