BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046369
         (240 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2JBW|A Chain A, Crystal Structure Of The 2,6-Dihydroxy-Pseudo-Oxynicotine
           Hydrolase.
 pdb|2JBW|B Chain B, Crystal Structure Of The 2,6-Dihydroxy-Pseudo-Oxynicotine
           Hydrolase.
 pdb|2JBW|C Chain C, Crystal Structure Of The 2,6-Dihydroxy-Pseudo-Oxynicotine
           Hydrolase.
 pdb|2JBW|D Chain D, Crystal Structure Of The 2,6-Dihydroxy-Pseudo-Oxynicotine
           Hydrolase
          Length = 386

 Score = 27.3 bits (59), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 151 GLLRQSLQKKYHLKNAPCDPCLVHCCLHWCALC 183
           G+L +SL   Y LK+A C+P L   C+ W    
Sbjct: 226 GVLGRSLGGNYALKSAACEPRLA-ACISWGGFS 257


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.464 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,814,122
Number of Sequences: 62578
Number of extensions: 316563
Number of successful extensions: 462
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 458
Number of HSP's gapped (non-prelim): 11
length of query: 240
length of database: 14,973,337
effective HSP length: 96
effective length of query: 144
effective length of database: 8,965,849
effective search space: 1291082256
effective search space used: 1291082256
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)