Query         046370
Match_columns 72
No_of_seqs    86 out of 88
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 11:26:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046370.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046370hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10890 DUF2741:  Protein of u 100.0 5.1E-44 1.1E-48  223.9   3.4   72    1-72      1-72  (72)
  2 PF02939 UcrQ:  UcrQ family;  I  99.8 6.8E-20 1.5E-24  116.1   1.9   51    7-60      9-60  (80)
  3 KOG4116 Ubiquinol cytochrome c  99.7   1E-17 2.2E-22  108.7   2.3   61    5-68     15-78  (90)
  4 PF12829 Mhr1:  Transcriptional  43.8      13 0.00028   24.1   1.1   33    6-42     11-50  (91)
  5 KOG4782 Predicted membrane pro  43.6     2.1 4.6E-05   28.7  -2.7   28   41-68     59-86  (108)
  6 COG4626 Phage terminase-like p  27.6      13 0.00028   30.9  -1.1   29   12-40     59-88  (546)
  7 COG5051 RPL36A Ribosomal prote  24.2      18  0.0004   23.9  -0.7   11   14-24     49-59  (97)
  8 PF01158 Ribosomal_L36e:  Ribos  23.0      17 0.00036   24.0  -1.0   14   14-28     47-60  (98)
  9 PF14021 DUF4237:  Protein of u  21.4      34 0.00074   21.7   0.2   22   15-36     25-46  (90)
 10 PF00662 Oxidored_q1_N:  NADH-U  20.5      17 0.00036   20.9  -1.3   17   56-72     40-56  (62)

No 1  
>PF10890 DUF2741:  Protein of unknown function (DUF2741);  InterPro: IPR020101 This entry represents subunit 8 of the Cytochrome b-c1 complex. The ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone. In plants, the b-c1 complex contains 10 subunits: 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins.
Probab=100.00  E-value=5.1e-44  Score=223.89  Aligned_cols=72  Identities=75%  Similarity=1.287  Sum_probs=71.5

Q ss_pred             CCCcceeeeeEEEEeCccccccccccccchhhhhhhhhhccccceeeeecceeeehhhHHHHHHHHHhhhcC
Q 046370            1 MGKQPVRMKAVVYALSPFQQKIMPGLWKDLTGKIHHKVSDNWISTILLLGPLVGTYAYVQNYQEKEKLAHRY   72 (72)
Q Consensus         1 mgk~~vrlr~VtYsLSPfEQra~~g~f~~~p~~i~RR~~en~~~~~~~v~Pfv~~y~y~~~~~e~ekl~hr~   72 (72)
                      |||+|||+|+|+|+||||||++|+|+|||+|.+|+|+|+|||+|++++++|++|+|+||+||+|||||+|||
T Consensus         1 Mgk~pvrlkeVvY~LSP~qq~Vm~GLwKDlp~ki~hk~~enwv~a~~~~~p~~Gt~~Ya~~y~e~EKL~HRy   72 (72)
T PF10890_consen    1 MGKQPVRLKEVVYALSPFQQKVMPGLWKDLPKKIHHKFSENWVSATLFLVPLVGTYWYAENYKEQEKLEHRY   72 (72)
T ss_pred             CCCCccchhHheeeeChhhhhhhhhhhhhcHHHHHHHHhhcceeeEEEeeeehhhHHHHHHHHHHHhhhccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998


No 2  
>PF02939 UcrQ:  UcrQ family;  InterPro: IPR004205 The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is a respiratory multi-enzyme complex [], which recognises a mitochondrial targeting presequence. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske protein), 2 core proteins and 6 low molecular weight proteins. This family represents the 9.5 kDa subunit of the complex. This subunit together with cytochrome B binds to ubiquinone.; GO: 0008121 ubiquinol-cytochrome-c reductase activity; PDB: 1L0N_G 1SQQ_G 1PP9_G 1PPJ_T 2FYU_G 2BCC_G 1BCC_G 2A06_G 1NTZ_G 2YBB_g ....
Probab=99.77  E-value=6.8e-20  Score=116.09  Aligned_cols=51  Identities=20%  Similarity=0.404  Sum_probs=40.0

Q ss_pred             eeee-EEEEeCccccccccccccchhhhhhhhhhccccceeeeecceeeehhhHH
Q 046370            7 RMKA-VVYALSPFQQKIMPGLWKDLTGKIHHKVSDNWISTILLLGPLVGTYAYVQ   60 (72)
Q Consensus         7 rlr~-VtYsLSPfEQra~~g~f~~~p~~i~RR~~en~~~~~~~v~Pfv~~y~y~~   60 (72)
                      |+|+ |||+|||||||+|+|.|+++++|++||+++++   +++++||+++|.--+
T Consensus         9 k~kgi~tYslSP~eQr~~ag~~~~~i~N~~RR~~~q~---~~v~ppfi~~y~i~~   60 (80)
T PF02939_consen    9 KQKGIITYSLSPFEQRPFAGAFSKGIFNTFRRFRSQV---LYVAPPFIVGYLIYD   60 (80)
T ss_dssp             --EEEEEEEE-TTGB-SSTTTTTTHHHHHHHHHHHHH---HHHHHHHHHHHHHHH
T ss_pred             cccceEEEEeChhhhcccccchHhhHhHHHHHHHHHh---HHHhhHHHHHHHHHH
Confidence            8999 99999999999999999999999999999955   455559988765433


No 3  
>KOG4116 consensus Ubiquinol cytochrome c reductase, subunit QCR8 [Energy production and conversion]
Probab=99.68  E-value=1e-17  Score=108.74  Aligned_cols=61  Identities=21%  Similarity=0.384  Sum_probs=48.4

Q ss_pred             ceeeee-EEEEeCccccccccccccchhhhhhhhhhccccceeeeec-ceee-ehhhHHHHHHHHHh
Q 046370            5 PVRMKA-VVYALSPFQQKIMPGLWKDLTGKIHHKVSDNWISTILLLG-PLVG-TYAYVQNYQEKEKL   68 (72)
Q Consensus         5 ~vrlr~-VtYsLSPfEQra~~g~f~~~p~~i~RR~~en~~~~~~~v~-Pfv~-~y~y~~~~~e~ekl   68 (72)
                      |-|+++ |+|+||||||||++|.|+++.+|++||++++.   +++++ +||+ -|.|+.--.++|.|
T Consensus        15 l~K~~giisYaLSPfeQra~~g~F~~~~~n~fRr~~~~~---~y~~iP~~Iv~yliy~wg~e~ne~l   78 (90)
T KOG4116|consen   15 LGKMKGIISYALSPFEQRAYAGFFDKAFPNMFRRFRSDQ---LYVVIPQFIVAYLIYDWGKETNEAL   78 (90)
T ss_pred             chhccceEEEecCchhhccccchhhhhhHHHHHHhhhcc---EEEEeccceEEEEEEecchhHhHHH
Confidence            458999 99999999999999999999999999999843   66666 6673 34555555556655


No 4  
>PF12829 Mhr1:  Transcriptional regulation of mitochondrial recombination;  InterPro: IPR024629 These proteins are involved in regulation of RNA polymerase II-dependent transcription. They are also involved in regulation of mitochondrial DNA recombination, maintenance, repair, and generation of homoplasmic cells [, , , ].
Probab=43.81  E-value=13  Score=24.12  Aligned_cols=33  Identities=30%  Similarity=0.532  Sum_probs=23.6

Q ss_pred             eeeeeEEEEeCcc-------ccccccccccchhhhhhhhhhccc
Q 046370            6 VRMKAVVYALSPF-------QQKIMPGLWKDLTGKIHHKVSDNW   42 (72)
Q Consensus         6 vrlr~VtYsLSPf-------EQra~~g~f~~~p~~i~RR~~en~   42 (72)
                      ++-.+|.||++|-       .|=.++| |+.-|++ +||  |-|
T Consensus        11 l~t~QVlYS~~p~l~~~~i~~Q~~~~g-kk~~pp~-lRk--D~W   50 (91)
T PF12829_consen   11 LETNQVLYSQTPNLDNNQILKQFPFPG-KKNKPPS-LRK--DYW   50 (91)
T ss_pred             cccCCEEEecCcccChhHHHHhccCCC-cccCCch-hcc--ccc
Confidence            3444599999994       4667777 8888998 443  556


No 5  
>KOG4782 consensus Predicted membrane protein [Function unknown]
Probab=43.61  E-value=2.1  Score=28.70  Aligned_cols=28  Identities=21%  Similarity=0.269  Sum_probs=21.0

Q ss_pred             cccceeeeecceeeehhhHHHHHHHHHh
Q 046370           41 NWISTILLLGPLVGTYAYVQNYQEKEKL   68 (72)
Q Consensus        41 n~~~~~~~v~Pfv~~y~y~~~~~e~ekl   68 (72)
                      |.++-..+.+-.++.|||+-.+..||+.
T Consensus        59 N~is~a~i~alViaIY~YTfYSikQErF   86 (108)
T KOG4782|consen   59 NHISFAGIGALVIAIYGYTFYSIKQERF   86 (108)
T ss_pred             hhhhhHHHHHHHHHhhhheeeehhHHHH
Confidence            5555555555888999999998888863


No 6  
>COG4626 Phage terminase-like protein, large subunit [General function prediction only]
Probab=27.64  E-value=13  Score=30.91  Aligned_cols=29  Identities=17%  Similarity=0.205  Sum_probs=24.0

Q ss_pred             EEEeCcccccccccccc-chhhhhhhhhhc
Q 046370           12 VYALSPFQQKIMPGLWK-DLTGKIHHKVSD   40 (72)
Q Consensus        12 tYsLSPfEQra~~g~f~-~~p~~i~RR~~e   40 (72)
                      -.+|+|+|+=+++.+|. --...-.|||.|
T Consensus        59 p~~l~PwQkFiia~l~G~~~k~T~~rrf~e   88 (546)
T COG4626          59 PESLEPWQKFIVAALFGFYDKQTGIRRFKE   88 (546)
T ss_pred             ccccchHHHHHHHHHhceeecCCCceEEEE
Confidence            67899999999999997 444455789998


No 7  
>COG5051 RPL36A Ribosomal protein L36E [Translation, ribosomal structure and biogenesis]
Probab=24.24  E-value=18  Score=23.92  Aligned_cols=11  Identities=27%  Similarity=0.921  Sum_probs=9.6

Q ss_pred             EeCcccccccc
Q 046370           14 ALSPFQQKIMP   24 (72)
Q Consensus        14 sLSPfEQra~~   24 (72)
                      .|||||.|++.
T Consensus        49 GlsPyErr~i~   59 (97)
T COG5051          49 GLSPYERRVIE   59 (97)
T ss_pred             cCCHHHHHHHH
Confidence            58999999984


No 8  
>PF01158 Ribosomal_L36e:  Ribosomal protein L36e;  InterPro: IPR000509 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. The L36E ribosomal family consists of mammalian, Caenorhabditis elegans and Drosophila L36, Candida albicans L39, and yeast YL39 ribosomal proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1B_Q 4A1D_Q 4A19_Q 4A18_Q 3IZS_k 3IZR_k.
Probab=23.03  E-value=17  Score=23.97  Aligned_cols=14  Identities=29%  Similarity=0.748  Sum_probs=11.3

Q ss_pred             EeCcccccccccccc
Q 046370           14 ALSPFQQKIMPGLWK   28 (72)
Q Consensus        14 sLSPfEQra~~g~f~   28 (72)
                      .+||||.++| .+++
T Consensus        47 GfaPYEkr~m-ELlk   60 (98)
T PF01158_consen   47 GFAPYEKRAM-ELLK   60 (98)
T ss_dssp             HHCHHHHHHH-HHHH
T ss_pred             CCChHHHHHH-HHHh
Confidence            4799999999 5566


No 9  
>PF14021 DUF4237:  Protein of unknown function (DUF4237)
Probab=21.38  E-value=34  Score=21.73  Aligned_cols=22  Identities=18%  Similarity=0.262  Sum_probs=15.0

Q ss_pred             eCccccccccccccchhhhhhh
Q 046370           15 LSPFQQKIMPGLWKDLTGKIHH   36 (72)
Q Consensus        15 LSPfEQra~~g~f~~~p~~i~R   36 (72)
                      =.|||||++|--..+.+....+
T Consensus        25 gtpf~~RaLpp~~~~~~Y~~Y~   46 (90)
T PF14021_consen   25 GTPFEQRALPPESLEKPYHVYE   46 (90)
T ss_pred             CCCHHHcCCCCcccCCCCEEEE
Confidence            3699999999655555555333


No 10 
>PF00662 Oxidored_q1_N:  NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus;  InterPro: IPR001516  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This domain represents an N-terminal extension of IPR001750 from INTERPRO. It contains NADH-Ubiquinone chain 5 and eubacterial chain L; these are found in the NADH:ubiquinone oxidoreductase (complex I) which catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane [].; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0042773 ATP synthesis coupled electron transport, 0055114 oxidation-reduction process; PDB: 3RKO_L.
Probab=20.47  E-value=17  Score=20.92  Aligned_cols=17  Identities=18%  Similarity=0.350  Sum_probs=12.0

Q ss_pred             hhhHHHHHHHHHhhhcC
Q 046370           56 YAYVQNYQEKEKLAHRY   72 (72)
Q Consensus        56 y~y~~~~~e~ekl~hr~   72 (72)
                      --|+..|+++|+--+||
T Consensus        40 ~~yS~~YM~~d~~~~rF   56 (62)
T PF00662_consen   40 HIYSIGYMSHDPNYNRF   56 (62)
T ss_dssp             HHHHHHHTSS-S-HHHH
T ss_pred             eeccccccccCCCcchh
Confidence            46888999999887775


Done!