BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046374
(420 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2FDR|A Chain A, Crystal Structure Of Conserved Haloacid Dehalogenase-like
Protein Of Unknown Function Atu0790 From Agrobacterium
Tumefaciens Str. C58
Length = 229
Score = 30.0 bits (66), Expect = 2.2, Method: Compositional matrix adjust.
Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 14/121 (11%)
Query: 136 IAACVQRDLLLLENQLPFPVLKELMSFRFSEDQWKKMLSNFVAQIRGPVKINKSFSRKAQ 195
IAA V+ LL + +P+ E RF+ WK +L ++ P ++ S K++
Sbjct: 21 IAAQVESRLL---TEAGYPISVEEXGERFAGXTWKNILLQVESEASIP--LSASLLDKSE 75
Query: 196 AQADHQLIHFEDEPAHLLEVVRTQLIEKSAYTIPPPSCSDWSSYRSTKELKAVGI--HFR 253
D +L + +++ V+ L S T P CS+ SS+R L VG+ +F
Sbjct: 76 KLLDXRL----ERDVKIIDGVKFAL---SRLTTPRCICSNSSSHRLDXXLTKVGLKPYFA 128
Query: 254 P 254
P
Sbjct: 129 P 129
>pdb|1R08|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|1R09|3 Chain 3, Human Rhinovirus 14 Complexed With Antiviral Compound R
61837
pdb|1RMU|3 Chain 3, Three-Dimensional Structures Of Drug-Resistant Mutants Of
Human Rhinovirus 14
pdb|2R04|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2R06|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2R07|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RM2|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RMU|3 Chain 3, Three-Dimensional Structures Of Drug-Resistant Mutants Of
Human Rhinovirus 14
pdb|2RR1|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RS1|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RS3|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RS5|3 Chain 3, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|4RHV|3 Chain 3, The Use Of Molecular-Replacement Phases For The Refinement
Of The Human Rhinovirus 14 Structure
pdb|1HRI|3 Chain 3, Structure Determination Of Antiviral Compound Sch 38057
Complexed With Human Rhinovirus 14
pdb|2HWB|3 Chain 3, A Comparison Of The Anti-Rhinoviral Drug Binding Pocket In
Hrv14 And Hrv1a
pdb|2HWC|3 Chain 3, A Comparison Of The Anti-Rhinoviral Drug Binding Pocket In
Hrv14 And Hrv1a
pdb|1HRV|3 Chain 3, Hrv14SDZ 35-682 Complex
pdb|1RUJ|3 Chain 3, Rhinovirus 14 Mutant With Ser 1 223 Replaced By Gly
(S1223g)
pdb|1RUI|3 Chain 3, Rhinovirus 14 Mutant S1223g Complexed With Antiviral
Compound Win 52084
pdb|1RUH|3 Chain 3, Rhinovirus 14 Mutant N1219s Complexed With Antiviral
Compound Win 52084
pdb|1RUG|3 Chain 3, Rhinovirus 14 Mutant N1219s Complexed With Antiviral
Compound Win 52035
pdb|1RUF|3 Chain 3, Rhinovirus 14 (Hrv14) (Mutant With Asn 1 219 Replaced By
Ala (N219a In Chain 1)
pdb|1RUE|3 Chain 3, Rhinovirus 14 Site Directed Mutant N1219a Complexed With
Antiviral Compound Win 52035
pdb|1RUD|3 Chain 3, Rhinovirus 14 Mutant N1105s Complexed With Antiviral
Compound Win 52084
pdb|1RUC|3 Chain 3, Rhinovirus 14 Mutant N1105s Complexed With Antiviral
Compound Win 52035
pdb|1VRH|3 Chain 3, Hrv14/sdz 880-061 Complex
pdb|1RVF|3 Chain 3, Fab Complexed With Intact Human Rhinovirus
pdb|1D3I|3 Chain 3, Cryo-Em Structure Of Human Rhinovirus 14 (Hrv14) Complexed
With A Two-Domain Fragment Of Its Cellular Receptor,
Intercellular Adhesion Molecule-1 (D1d2-Icam-1).
Implications For Virus-Receptor Interactions. Alpha
Carbons Only
pdb|1K5M|C Chain C, Crystal Structure Of A Human Rhinovirus Type 14:human
Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus Mn-
Iii-2
pdb|1NA1|C Chain C, The Structure Of Hrv14 When Complexed With Pleconaril
pdb|1NCQ|C Chain C, The Structure Of Hrv14 When Complexed With Pleconaril, An
Antiviral Compound
Length = 236
Score = 29.6 bits (65), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
Query: 249 GIHFRPSKTRKFTDVTFISMFFEAFLKLPPITIDDSTESMLLNMVAYEACPE 300
G+ FR + +T F+S +++ L LPP + + + LL+ ++ ACP+
Sbjct: 170 GVQFRYTDPDTYTSAGFLSCWYQTSLILPP---ETTGQVYLLSFIS--ACPD 216
>pdb|1EHY|A Chain A, X-Ray Structure Of The Epoxide Hydrolase From
Agrobacterium Radiobacter Ad1
pdb|1EHY|B Chain B, X-Ray Structure Of The Epoxide Hydrolase From
Agrobacterium Radiobacter Ad1
pdb|1EHY|C Chain C, X-Ray Structure Of The Epoxide Hydrolase From
Agrobacterium Radiobacter Ad1
pdb|1EHY|D Chain D, X-Ray Structure Of The Epoxide Hydrolase From
Agrobacterium Radiobacter Ad1
Length = 294
Score = 28.5 bits (62), Expect = 7.0, Method: Compositional matrix adjust.
Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 3/69 (4%)
Query: 16 LEKVPRIFREKKAKKNCFDPFVVSIGPYHHGKPELQ---FMEKHKLTMAQQYVSNNLHML 72
L K R + ++ K FDP GP + G + + + H+L MA + V ++ +
Sbjct: 113 LHKFIRKYSDRVIKAAIFDPIQPDFGPVYFGLGHVHESWYSQFHQLDMAVEVVGSSREVC 172
Query: 73 EELYKKVLD 81
++ +K D
Sbjct: 173 KKYFKHFFD 181
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.136 0.414
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,142,654
Number of Sequences: 62578
Number of extensions: 476407
Number of successful extensions: 996
Number of sequences better than 100.0: 51
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 48
Number of HSP's that attempted gapping in prelim test: 993
Number of HSP's gapped (non-prelim): 51
length of query: 420
length of database: 14,973,337
effective HSP length: 101
effective length of query: 319
effective length of database: 8,652,959
effective search space: 2760293921
effective search space used: 2760293921
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)