BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046385
         (218 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1H79|A Chain A, Structural Basis For Allosteric Substrate Specificity
           Regulation In Class Iii Ribonucleotide Reductases: Nrdd
           In Complex With Dttp
 pdb|1H7A|A Chain A, Structural Basis For Allosteric Substrate Specificity
           Regulation In Class Iii Ribonucleotide Reductases: Nrdd
           In Complex With Datp
 pdb|1H7B|A Chain A, Structural Basis For Allosteric Substrate Specificity
           Regulation In Class Iii Ribonucleotide Reductases,
           Native Nrdd
 pdb|1H78|A Chain A, Structural Basis For Allosteric Substrate Specificity
           Regulation In Class Iii Ribonucleotide Reductases: Nrdd
           In Complex With Dctp.
 pdb|1HK8|A Chain A, Structural Basis For Allosteric Substrate Specificity
           Regulation In Class Iii Ribonucleotide Reductases: Nrdd
           In Complex With Dgtp
          Length = 605

 Score = 33.5 bits (75), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 10/92 (10%)

Query: 9   DIKIGVRRILRKQLIMLVKKLLKGSTKRQRVSTSSLTGSLYIQELLNGSPIFCYDLMRMD 68
           ++ I V R + ++++  +   LK  T+R     +    SLY     N     CY   ++D
Sbjct: 406 ELNILVGRDIGREILTKMNAHLKQWTER-----TGFAFSLYSTPAEN----LCYRFCKLD 456

Query: 69  KNGFISLCQLFKEKGWLSDSKHLTVEEKMAMF 100
              + S+  +  +KGW ++S H++VEE +  F
Sbjct: 457 TEKYGSVKDV-TDKGWYTNSFHVSVEENITPF 487


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,161,532
Number of Sequences: 62578
Number of extensions: 225772
Number of successful extensions: 458
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 458
Number of HSP's gapped (non-prelim): 1
length of query: 218
length of database: 14,973,337
effective HSP length: 95
effective length of query: 123
effective length of database: 9,028,427
effective search space: 1110496521
effective search space used: 1110496521
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)