BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046385
(218 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1H79|A Chain A, Structural Basis For Allosteric Substrate Specificity
Regulation In Class Iii Ribonucleotide Reductases: Nrdd
In Complex With Dttp
pdb|1H7A|A Chain A, Structural Basis For Allosteric Substrate Specificity
Regulation In Class Iii Ribonucleotide Reductases: Nrdd
In Complex With Datp
pdb|1H7B|A Chain A, Structural Basis For Allosteric Substrate Specificity
Regulation In Class Iii Ribonucleotide Reductases,
Native Nrdd
pdb|1H78|A Chain A, Structural Basis For Allosteric Substrate Specificity
Regulation In Class Iii Ribonucleotide Reductases: Nrdd
In Complex With Dctp.
pdb|1HK8|A Chain A, Structural Basis For Allosteric Substrate Specificity
Regulation In Class Iii Ribonucleotide Reductases: Nrdd
In Complex With Dgtp
Length = 605
Score = 33.5 bits (75), Expect = 0.090, Method: Compositional matrix adjust.
Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 10/92 (10%)
Query: 9 DIKIGVRRILRKQLIMLVKKLLKGSTKRQRVSTSSLTGSLYIQELLNGSPIFCYDLMRMD 68
++ I V R + ++++ + LK T+R + SLY N CY ++D
Sbjct: 406 ELNILVGRDIGREILTKMNAHLKQWTER-----TGFAFSLYSTPAEN----LCYRFCKLD 456
Query: 69 KNGFISLCQLFKEKGWLSDSKHLTVEEKMAMF 100
+ S+ + +KGW ++S H++VEE + F
Sbjct: 457 TEKYGSVKDV-TDKGWYTNSFHVSVEENITPF 487
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.137 0.403
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,161,532
Number of Sequences: 62578
Number of extensions: 225772
Number of successful extensions: 458
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 458
Number of HSP's gapped (non-prelim): 1
length of query: 218
length of database: 14,973,337
effective HSP length: 95
effective length of query: 123
effective length of database: 9,028,427
effective search space: 1110496521
effective search space used: 1110496521
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)