BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046408
         (102 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XY7|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis
          Thaliana At5g48480
 pdb|1XY7|B Chain B, X-Ray Structure Of Gene Product From Arabidopsis
          Thaliana At5g48480
 pdb|2Q48|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of
          Gene Product From Arabidopsis Thaliana At5g48480
 pdb|2Q48|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of
          Gene Product From Arabidopsis Thaliana At5g48480
          Length = 166

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%)

Query: 1  MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLS 53
           K  LLVEA KV DAV  YK+AFGA+E   ++  KRK +QEL   L +   L+
Sbjct: 26 FKQXLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELNLA 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.134    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,213,740
Number of Sequences: 62578
Number of extensions: 50623
Number of successful extensions: 115
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 113
Number of HSP's gapped (non-prelim): 2
length of query: 102
length of database: 14,973,337
effective HSP length: 67
effective length of query: 35
effective length of database: 10,780,611
effective search space: 377321385
effective search space used: 377321385
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)