BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046457
         (59 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9M9V7|PTR8_ARATH Probable peptide/nitrate transporter At1g18880 OS=Arabidopsis
           thaliana GN=At1g18880 PE=2 SV=1
          Length = 587

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 5/40 (12%)

Query: 25  IPFIVLHGIGDQCSNQG-----VKQFTENLSSFSGSKGYC 59
           IP +VL GI D  +  G      KQF EN+ SF+GS  YC
Sbjct: 461 IPQLVLMGIADALAGVGQMEFYYKQFPENMRSFAGSLYYC 500


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.330    0.143    0.438 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,527,763
Number of Sequences: 539616
Number of extensions: 544881
Number of successful extensions: 1322
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1322
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 191,569,459
effective HSP length: 32
effective length of query: 27
effective length of database: 174,301,747
effective search space: 4706147169
effective search space used: 4706147169
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 55 (25.8 bits)