Query         046457
Match_columns 59
No_of_seqs    110 out of 206
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 12:19:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046457.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046457hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02633 palmitoyl protein thi  99.8 1.2E-19 2.7E-24  131.7   5.1   57    1-59      4-60  (314)
  2 PLN02606 palmitoyl-protein thi  99.6 3.5E-16 7.6E-21  113.4   5.4   44   16-59     17-61  (306)
  3 PF02089 Palm_thioest:  Palmito  99.6 2.7E-16 5.9E-21  112.5   3.1   38   22-59      3-42  (279)
  4 KOG2541 Palmitoyl protein thio  99.6 1.5E-15 3.2E-20  110.1   5.4   52    8-59      5-58  (296)
  5 PF12695 Abhydrolase_5:  Alpha/  84.8     1.6 3.4E-05   25.5   3.2   25   26-52      1-25  (145)
  6 PF02230 Abhydrolase_2:  Phosph  83.4    0.95 2.1E-05   29.6   2.0   23   23-47     12-35  (216)
  7 TIGR02240 PHA_depoly_arom poly  82.0     1.4 3.1E-05   29.1   2.5   27   23-51     24-50  (276)
  8 PRK11460 putative hydrolase; P  81.0     2.6 5.7E-05   28.2   3.5   25   26-52     18-42  (232)
  9 PF10503 Esterase_phd:  Esteras  79.9       3 6.5E-05   28.8   3.6   30   23-52    168-198 (220)
 10 KOG1454 Predicted hydrolase/ac  77.4     1.2 2.7E-05   32.0   1.1   16   23-38     57-72  (326)
 11 PF12146 Hydrolase_4:  Putative  77.4       2 4.2E-05   25.0   1.8   23   27-51     19-41  (79)
 12 PRK10974 glycerol-3-phosphate   77.0       4 8.7E-05   29.2   3.6   53    3-57      5-58  (438)
 13 PF07519 Tannase:  Tannase and   76.9       3 6.5E-05   31.7   3.1   27   26-52    355-383 (474)
 14 cd04759 Rib_hydrolase ADP-ribo  74.9     4.2   9E-05   29.3   3.3   30   24-53    183-216 (242)
 15 PF12697 Abhydrolase_6:  Alpha/  73.3     4.8  0.0001   23.9   2.8   22   27-50      1-22  (228)
 16 PRK10985 putative hydrolase; P  71.1       6 0.00013   27.4   3.3   27   25-51     59-85  (324)
 17 PRK10349 carboxylesterase BioH  70.6     5.3 0.00012   25.9   2.8   28   23-52     12-39  (256)
 18 TIGR01840 esterase_phb esteras  70.1     7.7 0.00017   25.1   3.4   32   23-54    166-199 (212)
 19 KOG2112 Lysophospholipase [Lip  70.1     5.9 0.00013   27.9   3.1   16   25-40      4-19  (206)
 20 PRK11071 esterase YqiA; Provis  69.5     7.7 0.00017   25.3   3.4   26   26-51      3-28  (190)
 21 PF00326 Peptidase_S9:  Prolyl   66.7     9.6 0.00021   24.3   3.3   29   23-51    143-172 (213)
 22 PF02267 Rib_hydrolayse:  ADP-r  66.1     9.7 0.00021   27.3   3.5   28   25-52    185-216 (243)
 23 PF01674 Lipase_2:  Lipase (cla  65.4     3.9 8.5E-05   28.3   1.4   27   24-51      1-27  (219)
 24 PLN02824 hydrolase, alpha/beta  64.8     8.2 0.00018   25.7   2.8   25   25-51     30-54  (294)
 25 PLN02385 hydrolase; alpha/beta  64.4       9 0.00019   26.6   3.0   26   25-51     88-113 (349)
 26 PLN02211 methyl indole-3-aceta  63.7      11 0.00025   25.5   3.4   28   22-51     16-43  (273)
 27 PRK11126 2-succinyl-6-hydroxy-  63.4     4.5 9.8E-05   25.7   1.3   22   26-49      4-25  (242)
 28 TIGR03695 menH_SHCHC 2-succiny  62.7     9.8 0.00021   22.9   2.7   25   25-51      2-26  (251)
 29 PRK10673 acyl-CoA esterase; Pr  62.6     6.1 0.00013   25.2   1.8   27   23-51     15-41  (255)
 30 COG3571 Predicted hydrolase of  55.8      21 0.00046   25.3   3.7   32   20-51     10-41  (213)
 31 PF04083 Abhydro_lipase:  Parti  55.7     7.6 0.00017   22.1   1.3   15   24-38     43-57  (63)
 32 PF13823 ADH_N_assoc:  Alcohol   54.1     6.3 0.00014   18.9   0.6    8   28-35      4-11  (23)
 33 KOG4409 Predicted hydrolase/ac  52.5     8.6 0.00019   29.3   1.4   14   22-35     88-101 (365)
 34 cd03412 CbiK_N Anaerobic cobal  52.5      15 0.00033   22.9   2.4   31   27-57      4-35  (127)
 35 PF05057 DUF676:  Putative seri  51.3      19  0.0004   24.1   2.8   24   26-51      6-29  (217)
 36 PHA02857 monoglyceride lipase;  49.2      25 0.00055   23.0   3.1   28   22-49    207-235 (276)
 37 KOG1455 Lysophospholipase [Lip  48.7      20 0.00044   26.8   2.8   24   22-45    244-268 (313)
 38 PLN02679 hydrolase, alpha/beta  48.0      14  0.0003   26.2   1.8   25   25-51     89-113 (360)
 39 PRK10749 lysophospholipase L2;  47.6      24 0.00052   24.4   3.0   29   22-50    257-286 (330)
 40 PRK03592 haloalkane dehalogena  47.0      12 0.00026   24.9   1.3   26   24-51     27-52  (295)
 41 TIGR01738 bioH putative pimelo  47.0      23 0.00049   21.5   2.5   29   22-50    186-215 (245)
 42 COG2267 PldB Lysophospholipase  46.7      18  0.0004   25.5   2.3   24   25-53     35-58  (298)
 43 PLN03084 alpha/beta hydrolase   46.7      21 0.00046   26.2   2.7   26   24-51    127-152 (383)
 44 PRK06489 hypothetical protein;  46.5      12 0.00026   26.3   1.3   14   25-38     70-83  (360)
 45 COG1638 DctP TRAP-type C4-dica  45.7      50  0.0011   24.1   4.4   35   20-54     21-59  (332)
 46 PRK10566 esterase; Provisional  45.3      41  0.0009   21.6   3.6   28   24-51    186-214 (249)
 47 PRK03204 haloalkane dehalogena  44.4      24 0.00053   23.8   2.5   25   25-51     35-59  (286)
 48 PLN02298 hydrolase, alpha/beta  44.2      36 0.00077   23.2   3.3   27   23-49    250-277 (330)
 49 KOG1455 Lysophospholipase [Lip  43.3      26 0.00057   26.2   2.7   29   27-56     57-86  (313)
 50 PF13709 DUF4159:  Domain of un  40.6      47   0.001   22.6   3.4   27   25-51     54-81  (207)
 51 TIGR02821 fghA_ester_D S-formy  40.0      32  0.0007   23.3   2.6   28   23-50     40-69  (275)
 52 PF11165 DUF2949:  Protein of u  39.7     5.6 0.00012   22.9  -1.0   14   20-33     29-43  (58)
 53 PF10000 ACT_3:  ACT domain;  I  39.0      14 0.00031   21.6   0.6   20   40-59      2-26  (72)
 54 PF14336 DUF4392:  Domain of un  38.7      16 0.00035   26.2   1.0   23   30-53    178-201 (291)
 55 TIGR01249 pro_imino_pep_1 prol  38.6      38 0.00082   23.0   2.8   27   24-50    248-275 (306)
 56 cd03416 CbiX_SirB_N Sirohydroc  37.7      38 0.00082   19.6   2.3   27   27-53      3-29  (101)
 57 TIGR03056 bchO_mg_che_rel puta  36.2      44 0.00096   21.2   2.6   28   23-50    219-247 (278)
 58 PF06441 EHN:  Epoxide hydrolas  36.0      21 0.00045   22.4   1.1   16   20-35     88-103 (112)
 59 PRK14875 acetoin dehydrogenase  35.9      25 0.00053   23.9   1.5   26   24-51    131-156 (371)
 60 cd00707 Pancreat_lipase_like P  35.9      71  0.0015   22.1   3.8   23   25-47     37-59  (275)
 61 TIGR03101 hydr2_PEP hydrolase,  35.4      50  0.0011   23.2   3.0   25   26-50     27-53  (266)
 62 COG1075 LipA Predicted acetylt  35.3      38 0.00083   24.3   2.5   22   24-45     59-81  (336)
 63 TIGR03230 lipo_lipase lipoprot  35.0      52  0.0011   25.2   3.3   26   23-48     40-66  (442)
 64 PF04155 Ground-like:  Ground-l  34.1      35 0.00075   19.5   1.8   14   34-47      3-16  (76)
 65 PF03295 Pox_TAA1:  Poxvirus tr  33.1      41 0.00088   19.9   1.9   28   25-59     18-46  (63)
 66 PF11997 DUF3492:  Domain of un  31.8      33 0.00071   24.2   1.7   22   12-33    184-206 (268)
 67 cd08594 PI-PLCc_eta Catalytic   31.8 1.1E+02  0.0024   21.7   4.3   36   17-54     81-116 (227)
 68 PRK13604 luxD acyl transferase  31.7      61  0.0013   23.7   3.1   27   24-50    202-229 (307)
 69 TIGR01250 pro_imino_pep_2 prol  31.7      59  0.0013   20.2   2.6   28   23-50    230-257 (288)
 70 PF05728 UPF0227:  Uncharacteri  31.7      95  0.0021   20.7   3.8   27   27-53      2-28  (187)
 71 PF00561 Abhydrolase_1:  alpha/  31.6      45 0.00099   20.3   2.1   30   22-51    173-203 (230)
 72 TIGR01607 PST-A Plasmodium sub  31.4      56  0.0012   23.0   2.7   25   24-48    270-295 (332)
 73 COG1506 DAP2 Dipeptidyl aminop  31.1      89  0.0019   24.2   4.0   28   21-48    548-577 (620)
 74 PRK09474 malE maltose ABC tran  30.2 1.7E+02  0.0037   20.3   5.0   35   21-57     27-61  (396)
 75 TIGR03611 RutD pyrimidine util  30.2      64  0.0014   19.8   2.6   27   23-49    197-224 (257)
 76 PF06377 Adipokin_hormo:  Adipo  30.0      55  0.0012   18.3   2.0   20   33-52     18-39  (48)
 77 PRK05855 short chain dehydroge  29.6      31 0.00067   24.9   1.2   26   24-51     25-50  (582)
 78 TIGR03343 biphenyl_bphD 2-hydr  29.5      59  0.0013   21.0   2.5   27   23-49    222-249 (282)
 79 COG0400 Predicted esterase [Ge  29.3 1.1E+02  0.0024   20.9   3.9   32   21-52    143-175 (207)
 80 PRK10778 dksA RNA polymerase-b  29.2      42 0.00091   22.2   1.7   17   43-59     97-114 (151)
 81 PF01713 Smr:  Smr domain;  Int  29.2      66  0.0014   18.1   2.4   30   21-53     24-53  (83)
 82 TIGR03299 LGT_TIGR03299 phage/  28.9      21 0.00046   26.3   0.3   18   30-47     11-29  (309)
 83 PRK00923 sirohydrochlorin coba  28.5      67  0.0014   19.4   2.5   27   27-53      5-31  (126)
 84 PLN02652 hydrolase; alpha/beta  27.1      72  0.0016   23.4   2.8   26   24-49    324-350 (395)
 85 TIGR02420 dksA RNA polymerase-  27.0      49  0.0011   20.2   1.7   16   44-59     67-83  (110)
 86 PRK05634 nucleosidase; Provisi  26.9      64  0.0014   21.4   2.3   35   17-51    138-172 (185)
 87 TIGR02427 protocat_pcaD 3-oxoa  26.8      80  0.0017   19.0   2.6   28   23-50    192-220 (251)
 88 PF07819 PGAP1:  PGAP1-like pro  26.1      60  0.0013   22.0   2.1   23   22-44      2-25  (225)
 89 COG1448 TyrB Aspartate/tyrosin  26.1      46 0.00099   25.7   1.6   23   17-42    164-187 (396)
 90 TIGR01392 homoserO_Ac_trn homo  25.9   1E+02  0.0022   21.4   3.3   28   24-51    288-316 (351)
 91 PF01918 Alba:  Alba;  InterPro  25.8      38 0.00082   18.7   0.9   32   20-53     25-56  (70)
 92 PRK06026 5'-methylthioadenosin  25.6      78  0.0017   22.0   2.6   34   18-51    155-189 (212)
 93 PF00151 Lipase:  Lipase;  Inte  25.3      92   0.002   22.6   3.0   26   24-49     70-97  (331)
 94 PLN02894 hydrolase, alpha/beta  24.9      42 0.00092   24.4   1.3   12   25-36    106-117 (402)
 95 PLN02578 hydrolase              24.3      86  0.0019   22.0   2.7   29   23-51    295-324 (354)
 96 cd00286 Tubulin_FtsZ Tubulin/F  23.8 1.1E+02  0.0025   21.5   3.2   27   27-53     92-118 (328)
 97 PF06028 DUF915:  Alpha/beta hy  23.8      62  0.0014   22.8   1.9   27   22-50      9-35  (255)
 98 PLN02511 hydrolase              23.7 1.2E+02  0.0025   22.0   3.3   21   26-46    102-122 (388)
 99 PF15001 AP-5_subunit_s1:  AP-5  23.6      50  0.0011   22.9   1.3   12   27-38    105-116 (189)
100 PF03583 LIP:  Secretory lipase  23.4      57  0.0012   22.9   1.7   27   24-52    219-245 (290)
101 PF08874 DUF1835:  Domain of un  23.4      72  0.0016   19.2   1.9   35   22-57     84-119 (124)
102 cd08633 PI-PLCc_eta2 Catalytic  23.2 1.8E+02   0.004   21.0   4.2   35   17-53     81-115 (254)
103 COG5157 CDC73 RNA polymerase I  23.1      59  0.0013   24.8   1.7   28   25-57    205-233 (362)
104 PLN02442 S-formylglutathione h  23.1 1.4E+02  0.0029   20.5   3.4   29   23-51    216-246 (283)
105 cd03414 CbiX_SirB_C Sirohydroc  22.9      95  0.0021   18.3   2.4   27   27-53      4-30  (117)
106 cd03064 TRX_Fd_NuoE TRX-like [  22.3      87  0.0019   17.5   2.0   25   25-51     55-79  (80)
107 PF10216 ChpXY:  CO2 hydration   22.3      50  0.0011   25.2   1.2   14   27-40     87-102 (353)
108 PF01738 DLH:  Dienelactone hyd  22.3 1.3E+02  0.0028   19.2   3.0   31   22-52    143-174 (218)
109 PF00091 Tubulin:  Tubulin/FtsZ  22.0      77  0.0017   21.1   2.0   31   27-58    127-159 (216)
110 PF07521 RMMBL:  RNA-metabolisi  21.9      54  0.0012   17.0   1.0   15   18-32     26-40  (43)
111 PF14492 EFG_II:  Elongation Fa  21.8      88  0.0019   17.8   2.0   27   27-57     45-71  (75)
112 PRK11143 glpQ glycerophosphodi  21.7 3.1E+02  0.0067   20.1   5.2   34   18-51     19-53  (355)
113 cd00247 Endostatin-like Endost  21.7      40 0.00087   23.4   0.6   12   28-39    112-130 (171)
114 TIGR01705 MTA/SAH-nuc-hyp 5'-m  21.5 1.1E+02  0.0024   21.3   2.7   33   18-50    155-188 (212)
115 cd06059 Tubulin The tubulin su  20.9 1.3E+02  0.0029   21.9   3.2   27   27-53     92-118 (382)
116 PLN02965 Probable pheophorbida  20.4 1.2E+02  0.0027   19.7   2.7   28   23-50    192-220 (255)
117 TIGR02890 spore_yteA sporulati  20.2      78  0.0017   21.0   1.7   18   42-59     71-89  (159)
118 cd02186 alpha_tubulin The tubu  20.2 1.5E+02  0.0033   22.3   3.4   27   27-53    134-160 (434)

No 1  
>PLN02633 palmitoyl protein thioesterase family protein
Probab=99.78  E-value=1.2e-19  Score=131.72  Aligned_cols=57  Identities=46%  Similarity=0.743  Sum_probs=47.0

Q ss_pred             CCcccchHHHHHHHHHHHcccccCcceeEeeCCCCCCCChhHHHHHHHHhhccCCceeC
Q 046457            1 MAFRSVPISFITVLLLFFFPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKGYC   59 (59)
Q Consensus         1 ~~~~~~~~~~v~~~~~~~~~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~G~yv~c   59 (59)
                      |++|+.-+++  ..++.+++++.++|+|+||||||+|||+||++|+++++++.|+|++|
T Consensus         4 ~~~~~~~~~~--~~~~~~~~~~~~~P~ViwHG~GD~c~~~g~~~~~~l~~~~~g~~~~~   60 (314)
T PLN02633          4 GLKRSCVMVV--VAFLAMVHVSVSVPFIMLHGIGTQCSDATNANFTQLLTNLSGSPGFC   60 (314)
T ss_pred             cccchhhhHH--HHHHHhccccCCCCeEEecCCCcccCCchHHHHHHHHHhCCCCceEE
Confidence            3555333333  33458899999999999999999999999999999998877999997


No 2  
>PLN02606 palmitoyl-protein thioesterase
Probab=99.63  E-value=3.5e-16  Score=113.37  Aligned_cols=44  Identities=48%  Similarity=0.946  Sum_probs=38.5

Q ss_pred             HHH-cccccCcceeEeeCCCCCCCChhHHHHHHHHhhccCCceeC
Q 046457           16 LFF-FPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKGYC   59 (59)
Q Consensus        16 ~~~-~~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~G~yv~c   59 (59)
                      +.+ ++.++++|+|+||||||+|+|+||++++++|+++.|+|++|
T Consensus        17 ~~~~~~~~~~~PvViwHGlgD~~~~~~~~~~~~~i~~~~~~pg~~   61 (306)
T PLN02606         17 FFFSIPVSLSVPFVLFHGFGGECSNGKVSNLTQFLINHSGYPGTC   61 (306)
T ss_pred             HHhccccCCCCCEEEECCCCcccCCchHHHHHHHHHhCCCCCeEE
Confidence            344 66678999999999999999999999999997766888876


No 3  
>PF02089 Palm_thioest:  Palmitoyl protein thioesterase;  InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children. Mutations in the palmitoyl protein thioesterase gene causing infantile neuronal ceroid lipofuscinosis []. The most common mutation results in intracellular accumulation of the polypeptide and undetectable enzyme activity in the brain. Direct sequencing of cDNAs derived from brain RNA of INCL patients has shown a mis-sense transversion of A to T at nucleotide position 364, which results in substitution of Trp for Arg at position 122 in the protein - Arg 122 is immediately adjacent to a lipase consensus sequence that contains the putative active site Ser of PPT. The occurrence of this and two other independent mutations in the PPT gene strongly suggests that defects in this gene cause INCL.; GO: 0008474 palmitoyl-(protein) hydrolase activity, 0006464 protein modification process; PDB: 3GRO_B 1PJA_A 1EXW_A 1EH5_A 1EI9_A.
Probab=99.61  E-value=2.7e-16  Score=112.52  Aligned_cols=38  Identities=24%  Similarity=0.546  Sum_probs=26.5

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHHHHHHhhcc-CCceeC
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQFTENLSSFS-GSKGYC   59 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~~~ll~~~~-G~yv~c   59 (59)
                      ++++|+||||||||+|||+ ||+.++++|++.+ |+||||
T Consensus         3 ~~~~PvViwHGmGD~~~~~~~m~~i~~~i~~~~PG~yV~s   42 (279)
T PF02089_consen    3 PSPLPVVIWHGMGDSCCNPSSMGSIKELIEEQHPGTYVHS   42 (279)
T ss_dssp             TSS--EEEE--TT--S--TTTHHHHHHHHHHHSTT--EEE
T ss_pred             CCCCcEEEEEcCccccCChhHHHHHHHHHHHhCCCceEEE
Confidence            6789999999999999998 9999999999999 999996


No 4  
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones]
Probab=99.59  E-value=1.5e-15  Score=110.08  Aligned_cols=52  Identities=38%  Similarity=0.680  Sum_probs=43.8

Q ss_pred             HHHHHH-HHHHHcccccC-cceeEeeCCCCCCCChhHHHHHHHHhhccCCceeC
Q 046457            8 ISFITV-LLLFFFPVSRS-IPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKGYC   59 (59)
Q Consensus         8 ~~~v~~-~~~~~~~~~~~-~PvViwHGlGDsC~n~gm~~~~~ll~~~~G~yv~c   59 (59)
                      +++++. .++++++.+.+ +|+|+||||||+|+|-+|++++|+++|+.|+||+|
T Consensus         5 ~~~~l~~~~~~~~~~s~s~~P~ii~HGigd~c~~~~~~~~~q~l~~~~g~~v~~   58 (296)
T KOG2541|consen    5 ALVVLLLPFLALIHVSPSPVPVIVWHGIGDSCSSLSMANLTQLLEELPGSPVYC   58 (296)
T ss_pred             hhHHHHHHHHHhcccCcccCCEEEEeccCcccccchHHHHHHHHHhCCCCeeEE
Confidence            334333 34677777777 99999999999999999999999999966999998


No 5  
>PF12695 Abhydrolase_5:  Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A ....
Probab=84.79  E-value=1.6  Score=25.51  Aligned_cols=25  Identities=24%  Similarity=0.476  Sum_probs=19.6

Q ss_pred             ceeEeeCCCCCCCChhHHHHHHHHhhc
Q 046457           26 PFIVLHGIGDQCSNQGVKQFTENLSSF   52 (59)
Q Consensus        26 PvViwHGlGDsC~n~gm~~~~~ll~~~   52 (59)
                      |+|+.||.|.+  ...+..+.+.+.+.
T Consensus         1 ~vv~~HG~~~~--~~~~~~~~~~l~~~   25 (145)
T PF12695_consen    1 VVVLLHGWGGS--RRDYQPLAEALAEQ   25 (145)
T ss_dssp             EEEEECTTTTT--THHHHHHHHHHHHT
T ss_pred             CEEEECCCCCC--HHHHHHHHHHHHHC
Confidence            78999999985  44677888777765


No 6  
>PF02230 Abhydrolase_2:  Phospholipase/Carboxylesterase;  InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases.; GO: 0016787 hydrolase activity; PDB: 3U0V_A 1AUR_A 1AUO_B 1FJ2_B 3CN9_A 3CN7_A.
Probab=83.38  E-value=0.95  Score=29.57  Aligned_cols=23  Identities=35%  Similarity=0.586  Sum_probs=11.4

Q ss_pred             cCcc-eeEeeCCCCCCCChhHHHHHH
Q 046457           23 RSIP-FIVLHGIGDQCSNQGVKQFTE   47 (59)
Q Consensus        23 ~~~P-vViwHGlGDsC~n~gm~~~~~   47 (59)
                      ...| +|+.||.||+.  ..+....+
T Consensus        12 ~~~~lvi~LHG~G~~~--~~~~~~~~   35 (216)
T PF02230_consen   12 KAKPLVILLHGYGDSE--DLFALLAE   35 (216)
T ss_dssp             T-SEEEEEE--TTS-H--HHHHHHHH
T ss_pred             CCceEEEEECCCCCCc--chhHHHHh
Confidence            3345 45669999997  45555444


No 7  
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase. This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid.
Probab=82.03  E-value=1.4  Score=29.12  Aligned_cols=27  Identities=30%  Similarity=0.512  Sum_probs=17.1

Q ss_pred             cCcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           23 RSIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ...|+|++||+|++..  -...+.+.+.+
T Consensus        24 ~~~plvllHG~~~~~~--~w~~~~~~L~~   50 (276)
T TIGR02240        24 GLTPLLIFNGIGANLE--LVFPFIEALDP   50 (276)
T ss_pred             CCCcEEEEeCCCcchH--HHHHHHHHhcc
Confidence            3479999999998754  22344444443


No 8  
>PRK11460 putative hydrolase; Provisional
Probab=81.04  E-value=2.6  Score=28.18  Aligned_cols=25  Identities=16%  Similarity=0.399  Sum_probs=18.4

Q ss_pred             ceeEeeCCCCCCCChhHHHHHHHHhhc
Q 046457           26 PFIVLHGIGDQCSNQGVKQFTENLSSF   52 (59)
Q Consensus        26 PvViwHGlGDsC~n~gm~~~~~ll~~~   52 (59)
                      .+|+.||.|++-  ..+..+.+.+.+.
T Consensus        18 ~vIlLHG~G~~~--~~~~~l~~~l~~~   42 (232)
T PRK11460         18 LLLLFHGVGDNP--VAMGEIGSWFAPA   42 (232)
T ss_pred             EEEEEeCCCCCh--HHHHHHHHHHHHH
Confidence            488899999983  3577777777653


No 9  
>PF10503 Esterase_phd:  Esterase PHB depolymerase
Probab=79.91  E-value=3  Score=28.81  Aligned_cols=30  Identities=27%  Similarity=0.407  Sum_probs=21.2

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHHhhc
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENLSSF   52 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll~~~   52 (59)
                      ...|.++|||-.|.=.++ -..++.+...+.
T Consensus       168 ~~~P~~v~hG~~D~tV~~~n~~~~~~q~~~~  198 (220)
T PF10503_consen  168 PGYPRIVFHGTADTTVNPQNADQLVAQWLNV  198 (220)
T ss_pred             CCCCEEEEecCCCCccCcchHHHHHHHHHHc
Confidence            347999999999997777 455555544443


No 10 
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=77.40  E-value=1.2  Score=31.95  Aligned_cols=16  Identities=31%  Similarity=0.644  Sum_probs=13.6

Q ss_pred             cCcceeEeeCCCCCCC
Q 046457           23 RSIPFIVLHGIGDQCS   38 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~   38 (59)
                      ...|+|+.||.||++.
T Consensus        57 ~~~pvlllHGF~~~~~   72 (326)
T KOG1454|consen   57 DKPPVLLLHGFGASSF   72 (326)
T ss_pred             CCCcEEEeccccCCcc
Confidence            5689999999999654


No 11 
>PF12146 Hydrolase_4:  Putative lysophospholipase;  InterPro: IPR022742  This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. Many members are annotated as being lysophospholipases, and others as alpha-beta hydrolase fold-containing proteins. 
Probab=77.36  E-value=2  Score=25.04  Aligned_cols=23  Identities=22%  Similarity=0.577  Sum_probs=13.8

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      +++.||+|+.+.  -..++.+.+.+
T Consensus        19 v~i~HG~~eh~~--ry~~~a~~L~~   41 (79)
T PF12146_consen   19 VVIVHGFGEHSG--RYAHLAEFLAE   41 (79)
T ss_pred             EEEeCCcHHHHH--HHHHHHHHHHh
Confidence            678899987643  24444444433


No 12 
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional
Probab=77.04  E-value=4  Score=29.19  Aligned_cols=53  Identities=11%  Similarity=0.104  Sum_probs=33.4

Q ss_pred             cccchHHHHHHHHHHHcccccCcceeEeeCCCCCCCChhHHHHHHHHhhcc-CCce
Q 046457            3 FRSVPISFITVLLLFFFPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFS-GSKG   57 (59)
Q Consensus         3 ~~~~~~~~v~~~~~~~~~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~-G~yv   57 (59)
                      .|+.++-.++++ .........+-+.+||+.++. ...-+.++.+..++.+ |+-|
T Consensus         5 ~~~~~~~~~~~~-~~~~~~~~~~~i~~W~~~~~~-~~~~~~~~~~~F~~~~p~i~V   58 (438)
T PRK10974          5 LRSTALGLALGL-ALSGNAQAVTEIPFWHSMEGE-LGKEVDSLAQRFNASQPDYKI   58 (438)
T ss_pred             HHHHHHHHHHHH-hcccccccCceEEEecCCCCh-hHHHHHHHHHHHHHhCCCeEE
Confidence            577777777776 344455556799999987643 1124556666666655 6543


No 13 
>PF07519 Tannase:  Tannase and feruloyl esterase;  InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ]. It also includes several bacterial homologues of unknown function.
Probab=76.87  E-value=3  Score=31.66  Aligned_cols=27  Identities=15%  Similarity=0.333  Sum_probs=20.7

Q ss_pred             ceeEeeCCCCCCCCh--hHHHHHHHHhhc
Q 046457           26 PFIVLHGIGDQCSNQ--GVKQFTENLSSF   52 (59)
Q Consensus        26 PvViwHGlGDsC~n~--gm~~~~~ll~~~   52 (59)
                      -+++|||+-|..-+|  ++.-.++..+..
T Consensus       355 KLI~~HG~aD~~I~p~~ti~YY~~V~~~~  383 (474)
T PF07519_consen  355 KLILYHGWADPLIPPQGTIDYYERVVARM  383 (474)
T ss_pred             eEEEEecCCCCccCCCcHHHHHHHHHHhc
Confidence            389999999999988  666666665554


No 14 
>cd04759 Rib_hydrolase ADP-ribosyl cyclase (also known as cyclic ADP-ribose hydrolase or CD38) synthesizes the second messenger cyclic-ADP ribose (cADPR), which in turn releases calcium from internal stores. Mammals possess two membrane proteins, CD38 and BST-1/CD157, which exhibit ADP-ribosyl cyclase function, as well as intracellular soluble ADP-ribose cyclases. CD38 is involved in differentiation, adhesion, and cell proliferation, as well as diseases such as AIDS, diabetes, and B-cell chronic lymphocytic leukemia. The extramembrane domain of CD38 acts as a multifunctional enzyme and can synthesize cADPR from NAD+, hydrolyze NAD+, and cADPR to ADPR, as well as catalyze the exchange of the nicotinamide group of NADP+ with nicotinic acid under acidic conditions to yield NAADP+ (nicotinic acid-adenine dinucleotide phosphate), a metabolite involved in Ca2+ mobilization from acidic stores.
Probab=74.95  E-value=4.2  Score=29.29  Aligned_cols=30  Identities=20%  Similarity=0.451  Sum_probs=25.4

Q ss_pred             CcceeEeeCCC----CCCCChhHHHHHHHHhhcc
Q 046457           24 SIPFIVLHGIG----DQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        24 ~~PvViwHGlG----DsC~n~gm~~~~~ll~~~~   53 (59)
                      .+-+.+.|++|    |+|.+.++..+++.|++..
T Consensus       183 ~v~i~vvh~l~~~~~~sC~~~Si~~L~~~l~~~n  216 (242)
T cd04759         183 QVIIWVIHDLEGPNRDSCGSGSIKELESILKKRN  216 (242)
T ss_pred             eEEEEEEcCCCCCcccccccchHHHHHHHHHHcC
Confidence            36688999976    8999999999999999653


No 15 
>PF12697 Abhydrolase_6:  Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A ....
Probab=73.34  E-value=4.8  Score=23.94  Aligned_cols=22  Identities=27%  Similarity=0.587  Sum_probs=11.6

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHh
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLS   50 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~   50 (59)
                      +|+.||+|.+.  .....+.+.++
T Consensus         1 vv~~hG~~~~~--~~~~~~~~~l~   22 (228)
T PF12697_consen    1 VVFLHGFGGSS--ESWDPLAEALA   22 (228)
T ss_dssp             EEEE-STTTTG--GGGHHHHHHHH
T ss_pred             eEEECCCCCCH--HHHHHHHHHHh
Confidence            56777777664  23444444444


No 16 
>PRK10985 putative hydrolase; Provisional
Probab=71.14  E-value=6  Score=27.43  Aligned_cols=27  Identities=11%  Similarity=0.247  Sum_probs=18.6

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      -++|++||++.+..+.-+..+.+.+.+
T Consensus        59 p~vll~HG~~g~~~~~~~~~~~~~l~~   85 (324)
T PRK10985         59 PRLVLFHGLEGSFNSPYAHGLLEAAQK   85 (324)
T ss_pred             CEEEEeCCCCCCCcCHHHHHHHHHHHH
Confidence            358899999877555556666665554


No 17 
>PRK10349 carboxylesterase BioH; Provisional
Probab=70.57  E-value=5.3  Score=25.87  Aligned_cols=28  Identities=29%  Similarity=0.427  Sum_probs=17.8

Q ss_pred             cCcceeEeeCCCCCCCChhHHHHHHHHhhc
Q 046457           23 RSIPFIVLHGIGDQCSNQGVKQFTENLSSF   52 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~gm~~~~~ll~~~   52 (59)
                      .+.|+|+.||.|.+..  ....+.+.+++.
T Consensus        12 g~~~ivllHG~~~~~~--~w~~~~~~L~~~   39 (256)
T PRK10349         12 GNVHLVLLHGWGLNAE--VWRCIDEELSSH   39 (256)
T ss_pred             CCCeEEEECCCCCChh--HHHHHHHHHhcC
Confidence            3457999999985543  344555555543


No 18 
>TIGR01840 esterase_phb esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi.
Probab=70.12  E-value=7.7  Score=25.11  Aligned_cols=32  Identities=19%  Similarity=0.319  Sum_probs=23.9

Q ss_pred             cCcc-eeEeeCCCCCCCCh-hHHHHHHHHhhccC
Q 046457           23 RSIP-FIVLHGIGDQCSNQ-GVKQFTENLSSFSG   54 (59)
Q Consensus        23 ~~~P-vViwHGlGDsC~n~-gm~~~~~ll~~~~G   54 (59)
                      .+.| +.+|||.-|.=..+ ...++.+.+++.+|
T Consensus       166 ~~~p~~~i~hG~~D~vVp~~~~~~~~~~l~~~~~  199 (212)
T TIGR01840       166 GPTPIMSVVHGDADYTVLPGNADEIRDAMLKVYG  199 (212)
T ss_pred             CCCCeEEEEEcCCCceeCcchHHHHHHHHHHhcC
Confidence            3466 45999999997766 77777777777653


No 19 
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism]
Probab=70.12  E-value=5.9  Score=27.87  Aligned_cols=16  Identities=44%  Similarity=0.692  Sum_probs=12.0

Q ss_pred             cceeEeeCCCCCCCCh
Q 046457           25 IPFIVLHGIGDQCSNQ   40 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~   40 (59)
                      .-+|..||+||+=.+.
T Consensus         4 atIi~LHglGDsg~~~   19 (206)
T KOG2112|consen    4 ATIIFLHGLGDSGSGW   19 (206)
T ss_pred             EEEEEEecCCCCCccH
Confidence            3478889999995543


No 20 
>PRK11071 esterase YqiA; Provisional
Probab=69.46  E-value=7.7  Score=25.27  Aligned_cols=26  Identities=15%  Similarity=0.285  Sum_probs=17.9

Q ss_pred             ceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           26 PFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        26 PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      |+|+.||.|-+-.+.....+++.+++
T Consensus         3 ~illlHGf~ss~~~~~~~~~~~~l~~   28 (190)
T PRK11071          3 TLLYLHGFNSSPRSAKATLLKNWLAQ   28 (190)
T ss_pred             eEEEECCCCCCcchHHHHHHHHHHHH
Confidence            79999999876555444456666654


No 21 
>PF00326 Peptidase_S9:  Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification.;  InterPro: IPR001375 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain covers the active site serine of the serine peptidases belonging to MEROPS peptidase family S9 (prolyl oligopeptidase family, clan SC). The protein fold of the peptidase domain for members of this family resembles that of serine carboxypeptidase D, the type example of clan SC. Examples of protein families containing this domain are:   Prolyl endopeptidase (3.4.21.26 from EC) (PE) (also called post-proline cleaving enzyme). PE is an enzyme that cleaves peptide bonds on the C-terminal side of prolyl residues. The sequence of PE has been obtained from a mammalian species (pig) and from bacteria (Flavobacterium meningosepticum and Aeromonas hydrophila); there is a high degree of sequence conservation between these sequences.  Escherichia coli protease II (3.4.21.83 from EC) (oligopeptidase B) (gene prtB) which cleaves peptide bonds on the C-terminal side of lysyl and argininyl residues. Dipeptidyl peptidase IV (3.4.14.5 from EC) (DPP IV). DPP IV is an enzyme that removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.  Saccharomyces cerevisiae (Baker's yeast) vacuolar dipeptidyl aminopeptidases A and B (DPAP A and DPAP B), encoded by the STE13 and DAP2 genes respectively. DPAP A is responsible for the proteolytic maturation of the alpha-factor precursor. Acylamino-acid-releasing enzyme (3.4.19.1 from EC) (acyl-peptide hydrolase). This enzyme catalyses the hydrolysis of the amino-terminal peptide bond of an N-acetylated protein to generate a N-acetylated amino acid and a protein with a free amino-terminus.   These proteins belong to MEROPS peptidase families S9A, S9B and S9C.; GO: 0008236 serine-type peptidase activity, 0006508 proteolysis; PDB: 2AJ8_D 1ORV_D 2AJB_C 2BUC_D 1ORW_D 2AJC_D 2AJD_C 2BUA_A 2HU8_B 3O4J_B ....
Probab=66.67  E-value=9.6  Score=24.34  Aligned_cols=29  Identities=17%  Similarity=0.277  Sum_probs=20.5

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      ...|+.++||-.|.=+.+ ...++.+.|++
T Consensus       143 ~~~P~li~hG~~D~~Vp~~~s~~~~~~L~~  172 (213)
T PF00326_consen  143 IKPPVLIIHGENDPRVPPSQSLRLYNALRK  172 (213)
T ss_dssp             GGSEEEEEEETTBSSSTTHHHHHHHHHHHH
T ss_pred             CCCCEEEEccCCCCccCHHHHHHHHHHHHh
Confidence            579999999999987755 44444444443


No 22 
>PF02267 Rib_hydrolayse:  ADP-ribosyl cyclase;  InterPro: IPR003193 CD38, the HUGO gene name, is also called T10 or ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase (3.2.2.5 from EC). CD38 is a novel enzyme capable of catalysing multiple reactions, including NAD glycohydrolase, ADP-ribosyl cyclase, cyclic ADP ribose hydrolase and base-exchange activities. Two of the enzymatic products, cyclic ADP-ribose (cADPR) and nicotinic acid adenine dinucleotide phosphate (NAADP), are calcium messengers in a wide variety of cells from protist, plant, and mammal to human. CD38 is a positive and negative regulator of cell activation and proliferation, depending on the cellular environment. It is involved in adhesion between human lymphocytes and endothelial cells and is involved in the metabolism of two calcium messengers, cADPR and NAADP. CD157 (also called BP-3/IF-7, BST-1 or Mo5) has ADP-ribosyl cyclase and cyclic ADP-ribose hydrolase activities. CD157 supports the growth of a pre-B cell line, DW34. Anti-CD157 mAb IF-7 has synergistic effects on anti-CD3-induced growth of T progenitor cells, and facilitates the development of [alpha][beta] TCR+ cells in foetal thymic organ culture system. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/).; GO: 0003953 NAD+ nucleosidase activity; PDB: 2EG9_B 1YH3_A 3DZF_C 2HCT_A 2O3R_A 3DZI_A 1ZVM_D 3I9M_B 2I66_B 2O3T_B ....
Probab=66.06  E-value=9.7  Score=27.35  Aligned_cols=28  Identities=25%  Similarity=0.495  Sum_probs=23.7

Q ss_pred             cceeEeeCCC----CCCCChhHHHHHHHHhhc
Q 046457           25 IPFIVLHGIG----DQCSNQGVKQFTENLSSF   52 (59)
Q Consensus        25 ~PvViwHGlG----DsC~n~gm~~~~~ll~~~   52 (59)
                      +-+.+.|.+|    |+|.+.+|..+++.|++.
T Consensus       185 l~i~vvh~~~~~~~esC~~gSi~~L~~~l~~~  216 (243)
T PF02267_consen  185 LEIWVVHDIEGPSRESCGSGSIKELESILKSR  216 (243)
T ss_dssp             EEEEEEESSSSSSSSGTTSHHHHHHHHHHHHT
T ss_pred             EEEEEEecCCCCccCCCccHHHHHHHHHHHHc
Confidence            5578889664    899999999999999985


No 23 
>PF01674 Lipase_2:  Lipase (class 2);  InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []. This group of lipases has been called class 2 as they are not clearly related to other lipase families, and includes LipA and LipB from Bacillus subtilis [] and uncharacterised proteins from Caenorhabditis.; PDB: 2VTV_B 2X76_A 2X5X_A 2QXU_A 3QMM_A 1I6W_A 3D2C_J 2QXT_B 1R50_A 1T2N_A ....
Probab=65.39  E-value=3.9  Score=28.27  Aligned_cols=27  Identities=19%  Similarity=0.441  Sum_probs=12.9

Q ss_pred             CcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ..|||+.||.+++-.. ....+.+.+++
T Consensus         1 ~~PVVlVHG~~~~~~~-~w~~~~~~l~~   27 (219)
T PF01674_consen    1 NRPVVLVHGTGGNAYS-NWSTLAPYLKA   27 (219)
T ss_dssp             S--EEEE--TTTTTCG-GCCHHHHHHHH
T ss_pred             CCCEEEECCCCcchhh-CHHHHHHHHHH
Confidence            3799999999985332 23344444443


No 24 
>PLN02824 hydrolase, alpha/beta fold family protein
Probab=64.79  E-value=8.2  Score=25.67  Aligned_cols=25  Identities=20%  Similarity=0.408  Sum_probs=17.3

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      -|+|+.||.|.+..  ....+.+.+.+
T Consensus        30 ~~vlllHG~~~~~~--~w~~~~~~L~~   54 (294)
T PLN02824         30 PALVLVHGFGGNAD--HWRKNTPVLAK   54 (294)
T ss_pred             CeEEEECCCCCChh--HHHHHHHHHHh
Confidence            58999999998754  45555555554


No 25 
>PLN02385 hydrolase; alpha/beta fold family protein
Probab=64.39  E-value=9  Score=26.63  Aligned_cols=26  Identities=23%  Similarity=0.439  Sum_probs=17.0

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      -++|+.||+|+++.. ....+.+.+.+
T Consensus        88 ~~iv~lHG~~~~~~~-~~~~~~~~l~~  113 (349)
T PLN02385         88 AAVCFCHGYGDTCTF-FFEGIARKIAS  113 (349)
T ss_pred             eEEEEECCCCCccch-HHHHHHHHHHh
Confidence            458899999987642 34455555543


No 26 
>PLN02211 methyl indole-3-acetate methyltransferase
Probab=63.65  E-value=11  Score=25.52  Aligned_cols=28  Identities=14%  Similarity=0.229  Sum_probs=19.1

Q ss_pred             ccCcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           22 SRSIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ....|+|+.||.|.+..  ....+.+.+++
T Consensus        16 ~~~p~vvliHG~~~~~~--~w~~~~~~L~~   43 (273)
T PLN02211         16 RQPPHFVLIHGISGGSW--CWYKIRCLMEN   43 (273)
T ss_pred             CCCCeEEEECCCCCCcC--cHHHHHHHHHh
Confidence            34457999999987532  45666766654


No 27 
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=63.37  E-value=4.5  Score=25.66  Aligned_cols=22  Identities=27%  Similarity=0.324  Sum_probs=13.8

Q ss_pred             ceeEeeCCCCCCCChhHHHHHHHH
Q 046457           26 PFIVLHGIGDQCSNQGVKQFTENL   49 (59)
Q Consensus        26 PvViwHGlGDsC~n~gm~~~~~ll   49 (59)
                      |+|++||+|.+-  .....+.+.+
T Consensus         4 ~vvllHG~~~~~--~~w~~~~~~l   25 (242)
T PRK11126          4 WLVFLHGLLGSG--QDWQPVGEAL   25 (242)
T ss_pred             EEEEECCCCCCh--HHHHHHHHHc
Confidence            699999998752  2334444444


No 28 
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase.
Probab=62.69  E-value=9.8  Score=22.94  Aligned_cols=25  Identities=20%  Similarity=0.255  Sum_probs=15.3

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      -|+|+.||.|.+..  ....+.+.+.+
T Consensus         2 ~~vv~~hG~~~~~~--~~~~~~~~L~~   26 (251)
T TIGR03695         2 PVLVFLHGFLGSGA--DWQALIELLGP   26 (251)
T ss_pred             CEEEEEcCCCCchh--hHHHHHHHhcc
Confidence            36888899875422  45555555543


No 29 
>PRK10673 acyl-CoA esterase; Provisional
Probab=62.57  E-value=6.1  Score=25.18  Aligned_cols=27  Identities=15%  Similarity=0.407  Sum_probs=17.6

Q ss_pred             cCcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           23 RSIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ...|+|+.||.+++..  ....+.+.+.+
T Consensus        15 ~~~~iv~lhG~~~~~~--~~~~~~~~l~~   41 (255)
T PRK10673         15 NNSPIVLVHGLFGSLD--NLGVLARDLVN   41 (255)
T ss_pred             CCCCEEEECCCCCchh--HHHHHHHHHhh
Confidence            4478999999887643  34445555544


No 30 
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=55.76  E-value=21  Score=25.35  Aligned_cols=32  Identities=13%  Similarity=0.322  Sum_probs=26.4

Q ss_pred             ccccCcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           20 PVSRSIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        20 ~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      +-..+.-+++-||-|-+=.+++|.++.+.+..
T Consensus        10 ag~~~~tilLaHGAGasmdSt~m~~~a~~la~   41 (213)
T COG3571          10 AGPAPVTILLAHGAGASMDSTSMTAVAAALAR   41 (213)
T ss_pred             CCCCCEEEEEecCCCCCCCCHHHHHHHHHHHh
Confidence            34455778899999999999999999888764


No 31 
>PF04083 Abhydro_lipase:  Partial alpha/beta-hydrolase lipase region;  InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is similar: an alpha/beta sheet, not barrel, of eight beta-sheets connected by alpha-helices []. This entry represents the N-terminal part of an alpha/beta hydrolase domain found in a number of lipases.; GO: 0006629 lipid metabolic process; PDB: 1K8Q_B 1HLG_B.
Probab=55.74  E-value=7.6  Score=22.12  Aligned_cols=15  Identities=20%  Similarity=0.465  Sum_probs=6.7

Q ss_pred             CcceeEeeCCCCCCC
Q 046457           24 SIPFIVLHGIGDQCS   38 (59)
Q Consensus        24 ~~PvViwHGlGDsC~   38 (59)
                      ..|+++-|||.++..
T Consensus        43 k~pVll~HGL~~ss~   57 (63)
T PF04083_consen   43 KPPVLLQHGLLQSSD   57 (63)
T ss_dssp             --EEEEE--TT--GG
T ss_pred             CCcEEEECCcccChH
Confidence            356778899988754


No 32 
>PF13823 ADH_N_assoc:  Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B.
Probab=54.13  E-value=6.3  Score=18.92  Aligned_cols=8  Identities=50%  Similarity=0.837  Sum_probs=6.7

Q ss_pred             eEeeCCCC
Q 046457           28 IVLHGIGD   35 (59)
Q Consensus        28 ViwHGlGD   35 (59)
                      |.|||-+|
T Consensus         4 v~y~G~~~   11 (23)
T PF13823_consen    4 VVYHGPKD   11 (23)
T ss_dssp             EEEEETTE
T ss_pred             eEEeCCCc
Confidence            68999886


No 33 
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=52.54  E-value=8.6  Score=29.28  Aligned_cols=14  Identities=29%  Similarity=0.866  Sum_probs=11.8

Q ss_pred             ccCcceeEeeCCCC
Q 046457           22 SRSIPFIVLHGIGD   35 (59)
Q Consensus        22 ~~~~PvViwHGlGD   35 (59)
                      +..+|+|+.||.|-
T Consensus        88 ~~~~plVliHGyGA  101 (365)
T KOG4409|consen   88 ANKTPLVLIHGYGA  101 (365)
T ss_pred             cCCCcEEEEeccch
Confidence            45699999999984


No 34 
>cd03412 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), N-terminal domain. CbiK is part of the cobalt-early path for cobalamin biosynthesis. It catalyzes the insertion of cobalt into the oxidized form of precorrin-2, factor II (sirohydrochlorin), the second step of the anaerobic branch of vitamin B12 biosynthesis. CbiK belongs to the class II family of chelatases and is a homomeric enzyme that does not require ATP for its enzymatic activity.
Probab=52.46  E-value=15  Score=22.91  Aligned_cols=31  Identities=6%  Similarity=0.140  Sum_probs=24.7

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc-CCce
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS-GSKG   57 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~-G~yv   57 (59)
                      +++.||--|...+..+.++.+.+++.+ +..|
T Consensus         4 llv~fGS~~~~~~~~~~~i~~~l~~~~p~~~V   35 (127)
T cd03412           4 LLVSFGTSYPTAEKTIDAIEDKVRAAFPDYEV   35 (127)
T ss_pred             EEEeCCCCCHHHHHHHHHHHHHHHHHCCCCeE
Confidence            567899999866779999999998876 4443


No 35 
>PF05057 DUF676:  Putative serine esterase (DUF676);  InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases.
Probab=51.27  E-value=19  Score=24.07  Aligned_cols=24  Identities=13%  Similarity=0.350  Sum_probs=18.7

Q ss_pred             ceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           26 PFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        26 PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      =+|+.||++.+  ...|..+++.+++
T Consensus         6 LvV~vHGL~G~--~~d~~~~~~~l~~   29 (217)
T PF05057_consen    6 LVVFVHGLWGN--PADMRYLKNHLEK   29 (217)
T ss_pred             EEEEeCCCCCC--HHHHHHHHHHHHH
Confidence            47899999877  3378888887777


No 36 
>PHA02857 monoglyceride lipase; Provisional
Probab=49.22  E-value=25  Score=22.96  Aligned_cols=28  Identities=21%  Similarity=0.477  Sum_probs=22.6

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHHHHHH
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQFTENL   49 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~~~ll   49 (59)
                      ....|+.++||-.|.-+.+ ...++.+.+
T Consensus       207 ~i~~Pvliv~G~~D~i~~~~~~~~l~~~~  235 (276)
T PHA02857        207 KIKTPILILQGTNNEISDVSGAYYFMQHA  235 (276)
T ss_pred             cCCCCEEEEecCCCCcCChHHHHHHHHHc
Confidence            3459999999999999987 666766665


No 37 
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]
Probab=48.73  E-value=20  Score=26.79  Aligned_cols=24  Identities=29%  Similarity=0.718  Sum_probs=19.1

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHH
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQF   45 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~   45 (59)
                      ...+|+++.||-.|.=+.| +-+.+
T Consensus       244 ~vtvPflilHG~dD~VTDp~~Sk~L  268 (313)
T KOG1455|consen  244 EVTVPFLILHGTDDKVTDPKVSKEL  268 (313)
T ss_pred             cccccEEEEecCCCcccCcHHHHHH
Confidence            4569999999999999988 44433


No 38 
>PLN02679 hydrolase, alpha/beta fold family protein
Probab=48.01  E-value=14  Score=26.16  Aligned_cols=25  Identities=20%  Similarity=0.396  Sum_probs=15.8

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      .|+|+.||.|.+..  ....+.+.+.+
T Consensus        89 p~lvllHG~~~~~~--~w~~~~~~L~~  113 (360)
T PLN02679         89 PPVLLVHGFGASIP--HWRRNIGVLAK  113 (360)
T ss_pred             CeEEEECCCCCCHH--HHHHHHHHHhc
Confidence            68999999996532  33444444444


No 39 
>PRK10749 lysophospholipase L2; Provisional
Probab=47.59  E-value=24  Score=24.41  Aligned_cols=29  Identities=14%  Similarity=0.313  Sum_probs=23.3

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      ..+.|+.+.||-.|...++ +..++.+.++
T Consensus       257 ~i~~P~Lii~G~~D~vv~~~~~~~~~~~l~  286 (330)
T PRK10749        257 DITTPLLLLQAEEERVVDNRMHDRFCEART  286 (330)
T ss_pred             CCCCCEEEEEeCCCeeeCHHHHHHHHHHHh
Confidence            4569999999999999988 6566776664


No 40 
>PRK03592 haloalkane dehalogenase; Provisional
Probab=47.04  E-value=12  Score=24.88  Aligned_cols=26  Identities=19%  Similarity=0.284  Sum_probs=16.1

Q ss_pred             CcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ..|+|+.||.+.+..  ....+.+.+.+
T Consensus        27 g~~vvllHG~~~~~~--~w~~~~~~L~~   52 (295)
T PRK03592         27 GDPIVFLHGNPTSSY--LWRNIIPHLAG   52 (295)
T ss_pred             CCEEEEECCCCCCHH--HHHHHHHHHhh
Confidence            359999999985543  23344444443


No 41 
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH. This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin. Its exact function is unknown, but is proposed in ref 2. This enzyme belongs to the alpha/beta hydrolase fold family (pfam model pfam00561). Members of this family are restricted to the Proteobacteria.
Probab=47.04  E-value=23  Score=21.50  Aligned_cols=29  Identities=24%  Similarity=0.229  Sum_probs=21.2

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      ....|+.++||-.|....+ ....+.+.+.
T Consensus       186 ~i~~Pvlii~g~~D~~~~~~~~~~~~~~~~  215 (245)
T TIGR01738       186 NISVPFLRLYGYLDGLVPAKVVPYLDKLAP  215 (245)
T ss_pred             cCCCCEEEEeecCCcccCHHHHHHHHHhCC
Confidence            3458999999999998876 5555555543


No 42 
>COG2267 PldB Lysophospholipase [Lipid metabolism]
Probab=46.73  E-value=18  Score=25.47  Aligned_cols=24  Identities=17%  Similarity=0.477  Sum_probs=16.5

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      --+|+.||+||.     +++-.++++...
T Consensus        35 g~Vvl~HG~~Eh-----~~ry~~la~~l~   58 (298)
T COG2267          35 GVVVLVHGLGEH-----SGRYEELADDLA   58 (298)
T ss_pred             cEEEEecCchHH-----HHHHHHHHHHHH
Confidence            448899999985     555555555554


No 43 
>PLN03084 alpha/beta hydrolase fold protein; Provisional
Probab=46.73  E-value=21  Score=26.19  Aligned_cols=26  Identities=23%  Similarity=0.428  Sum_probs=17.5

Q ss_pred             CcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ..|+|+.||+|.+.  .....+.+.+.+
T Consensus       127 ~~~ivllHG~~~~~--~~w~~~~~~L~~  152 (383)
T PLN03084        127 NPPVLLIHGFPSQA--YSYRKVLPVLSK  152 (383)
T ss_pred             CCeEEEECCCCCCH--HHHHHHHHHHhc
Confidence            35899999998642  245566666655


No 44 
>PRK06489 hypothetical protein; Provisional
Probab=46.45  E-value=12  Score=26.28  Aligned_cols=14  Identities=36%  Similarity=0.591  Sum_probs=11.2

Q ss_pred             cceeEeeCCCCCCC
Q 046457           25 IPFIVLHGIGDQCS   38 (59)
Q Consensus        25 ~PvViwHGlGDsC~   38 (59)
                      .|+|+.||.|.+..
T Consensus        70 pplvllHG~~~~~~   83 (360)
T PRK06489         70 NAVLVLHGTGGSGK   83 (360)
T ss_pred             CeEEEeCCCCCchh
Confidence            48999999987643


No 45 
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism]
Probab=45.73  E-value=50  Score=24.09  Aligned_cols=35  Identities=11%  Similarity=0.154  Sum_probs=24.2

Q ss_pred             ccccCcceeEeeCCCCCCCCh---hHHHHHHHHhhcc-C
Q 046457           20 PVSRSIPFIVLHGIGDQCSNQ---GVKQFTENLSSFS-G   54 (59)
Q Consensus        20 ~~~~~~PvViwHGlGDsC~n~---gm~~~~~ll~~~~-G   54 (59)
                      ..+...++++.++.+.+=.+|   ++..|.+++++.+ |
T Consensus        21 ~~a~~~~~~l~~~~~~~~~~p~~~~~~~fa~~v~ekt~G   59 (332)
T COG1638          21 AAAAAGALVLRFSHVTPEGHPKGKAAKKFAELVEEKTGG   59 (332)
T ss_pred             HHHhhhceEEeecccCCCCCcHHHHHHHHHHHHHHHhCC
Confidence            344445677777766532333   9999999999988 5


No 46 
>PRK10566 esterase; Provisional
Probab=45.32  E-value=41  Score=21.58  Aligned_cols=28  Identities=18%  Similarity=0.430  Sum_probs=22.5

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      +.|+.+.||--|+-..+ ...++.+.+++
T Consensus       186 ~~P~Lii~G~~D~~v~~~~~~~l~~~l~~  214 (249)
T PRK10566        186 DRPLLLWHGLADDVVPAAESLRLQQALRE  214 (249)
T ss_pred             CCCEEEEEcCCCCcCCHHHHHHHHHHHHh
Confidence            68999999999998887 66666666654


No 47 
>PRK03204 haloalkane dehalogenase; Provisional
Probab=44.40  E-value=24  Score=23.81  Aligned_cols=25  Identities=16%  Similarity=0.182  Sum_probs=15.9

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      .|+|+.||.+++  +..-..+.+.+.+
T Consensus        35 ~~iv~lHG~~~~--~~~~~~~~~~l~~   59 (286)
T PRK03204         35 PPILLCHGNPTW--SFLYRDIIVALRD   59 (286)
T ss_pred             CEEEEECCCCcc--HHHHHHHHHHHhC
Confidence            589999999842  2244455555554


No 48 
>PLN02298 hydrolase, alpha/beta fold family protein
Probab=44.18  E-value=36  Score=23.20  Aligned_cols=27  Identities=41%  Similarity=0.615  Sum_probs=20.9

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHH
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENL   49 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll   49 (59)
                      -.+|+.+.||-.|.-..+ ...++.+.+
T Consensus       250 i~~PvLii~G~~D~ivp~~~~~~l~~~i  277 (330)
T PLN02298        250 VSIPFIVLHGSADVVTDPDVSRALYEEA  277 (330)
T ss_pred             cCCCEEEEecCCCCCCCHHHHHHHHHHh
Confidence            359999999999998877 555555554


No 49 
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]
Probab=43.29  E-value=26  Score=26.21  Aligned_cols=29  Identities=17%  Similarity=0.285  Sum_probs=20.0

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc-CCc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS-GSK   56 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~-G~y   56 (59)
                      ++++||.|-.|+.. +.++.+.+.+.- ++|
T Consensus        57 v~~~HG~g~~~s~~-~~~~a~~l~~~g~~v~   86 (313)
T KOG1455|consen   57 VFLCHGYGEHSSWR-YQSTAKRLAKSGFAVY   86 (313)
T ss_pred             EEEEcCCcccchhh-HHHHHHHHHhCCCeEE
Confidence            78999999998764 555656555543 444


No 50 
>PF13709 DUF4159:  Domain of unknown function (DUF4159)
Probab=40.62  E-value=47  Score=22.59  Aligned_cols=27  Identities=22%  Similarity=0.396  Sum_probs=21.0

Q ss_pred             cceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      .|++.|||-||-=-++ -+.++++.+++
T Consensus        54 yP~ly~~g~~~~~~s~~e~~~Lr~Yl~~   81 (207)
T PF13709_consen   54 YPFLYWPGHGDFPLSDEEIANLRRYLEN   81 (207)
T ss_pred             CCEEEEeCCCCCCCCHHHHHHHHHHHHc
Confidence            8999999998883344 77777777765


No 51 
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well.
Probab=39.96  E-value=32  Score=23.28  Aligned_cols=28  Identities=14%  Similarity=0.045  Sum_probs=17.0

Q ss_pred             cCcce-eEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           23 RSIPF-IVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        23 ~~~Pv-ViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      .+.|+ ++.||.|++..+- ....+.++++
T Consensus        40 ~~~P~vvllHG~~~~~~~~~~~~~~~~la~   69 (275)
T TIGR02821        40 GPVPVLWYLSGLTCTHENFMIKAGAQRFAA   69 (275)
T ss_pred             CCCCEEEEccCCCCCccHHHhhhHHHHHHh
Confidence            45675 6779999887643 2334445554


No 52 
>PF11165 DUF2949:  Protein of unknown function (DUF2949);  InterPro: IPR021336  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=39.74  E-value=5.6  Score=22.95  Aligned_cols=14  Identities=21%  Similarity=0.577  Sum_probs=11.1

Q ss_pred             ccccCcceeEee-CC
Q 046457           20 PVSRSIPFIVLH-GI   33 (59)
Q Consensus        20 ~~~~~~PvViwH-Gl   33 (59)
                      ....|.|+|+|. |+
T Consensus        29 ~~~~pLPmiLWqyGL   43 (58)
T PF11165_consen   29 QDQGPLPMILWQYGL   43 (58)
T ss_pred             ccCCCcchHHHHhcc
Confidence            456789999996 75


No 53 
>PF10000 ACT_3:  ACT domain;  InterPro: IPR018717 This domain has no known function.; PDB: 1ZVP_C.
Probab=39.03  E-value=14  Score=21.64  Aligned_cols=20  Identities=30%  Similarity=0.566  Sum_probs=14.0

Q ss_pred             hhHHHHHHHHhhcc-----CCceeC
Q 046457           40 QGVKQFTENLSSFS-----GSKGYC   59 (59)
Q Consensus        40 ~gm~~~~~ll~~~~-----G~yv~c   59 (59)
                      +|..+++++|++..     |.||+|
T Consensus         2 sGe~dL~~LL~~m~P~L~~~~yVF~   26 (72)
T PF10000_consen    2 SGETDLDTLLASMSPELNPGEYVFC   26 (72)
T ss_dssp             HHHHHHHHHCST-EEEE-SS-EEEE
T ss_pred             CcHhHHHHHHhhCCcEeCCCCEEEE
Confidence            46778888888764     899887


No 54 
>PF14336 DUF4392:  Domain of unknown function (DUF4392)
Probab=38.67  E-value=16  Score=26.20  Aligned_cols=23  Identities=30%  Similarity=0.469  Sum_probs=19.2

Q ss_pred             eeCCCCCCCCh-hHHHHHHHHhhcc
Q 046457           30 LHGIGDQCSNQ-GVKQFTENLSSFS   53 (59)
Q Consensus        30 wHGlGDsC~n~-gm~~~~~ll~~~~   53 (59)
                      .=|+||-= |+ ||+++++.+++.+
T Consensus       178 tigIGDGG-NEiGMG~v~~~v~~~i  201 (291)
T PF14336_consen  178 TIGIGDGG-NEIGMGNVKEAVKKHI  201 (291)
T ss_pred             EEEECCCc-hhcccChHHHHHHHhC
Confidence            34899986 77 9999999998766


No 55 
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily. This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.
Probab=38.57  E-value=38  Score=23.00  Aligned_cols=27  Identities=22%  Similarity=0.429  Sum_probs=20.6

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      ++|+.+.||-.|.-+.+ ...++.+.+.
T Consensus       248 ~~P~lii~g~~D~~~p~~~~~~~~~~~~  275 (306)
T TIGR01249       248 NIPTYIVHGRYDLCCPLQSAWALHKAFP  275 (306)
T ss_pred             CCCeEEEecCCCCCCCHHHHHHHHHhCC
Confidence            58999999999998866 5555555554


No 56 
>cd03416 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), N-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both are found in a wide range of bacteria. This subgroup also contains single domain proteins from archaea and bacteria which may represent the ancestral form of class II chelatases before domain duplication occurred.
Probab=37.69  E-value=38  Score=19.58  Aligned_cols=27  Identities=22%  Similarity=0.334  Sum_probs=21.1

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      +++-||--+.-.|..+.++.+.+++..
T Consensus         3 vlv~hGS~~~~~~~~~~~l~~~l~~~~   29 (101)
T cd03416           3 LLVGHGSRDPRAAEALEALAERLRERL   29 (101)
T ss_pred             EEEEcCCCCHHHHHHHHHHHHHHHhhC
Confidence            456699888766778888888888765


No 57 
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein. Members of this family belong to the alpha/beta fold family hydrolases (PFAM model pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity.
Probab=36.15  E-value=44  Score=21.21  Aligned_cols=28  Identities=18%  Similarity=0.306  Sum_probs=20.3

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      .+.|+.++||-.|....+ ...++.+.+.
T Consensus       219 i~~P~lii~g~~D~~vp~~~~~~~~~~~~  247 (278)
T TIGR03056       219 ITIPLHLIAGEEDKAVPPDESKRAATRVP  247 (278)
T ss_pred             CCCCEEEEEeCCCcccCHHHHHHHHHhcc
Confidence            358999999999998876 4444544443


No 58 
>PF06441 EHN:  Epoxide hydrolase N terminus;  InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (3.3.2.3 from EC) comprise a group of functionally related enzymes that catalyse the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarisation of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites, which arise during the biotransformation of foreign compounds []. This domain is often found in conjunction with IPR000073 from INTERPRO.; GO: 0004301 epoxide hydrolase activity, 0009636 response to toxin, 0016020 membrane; PDB: 3G0I_B 3G02_A 1QO7_A.
Probab=36.00  E-value=21  Score=22.38  Aligned_cols=16  Identities=31%  Similarity=0.640  Sum_probs=8.5

Q ss_pred             ccccCcceeEeeCCCC
Q 046457           20 PVSRSIPFIVLHGIGD   35 (59)
Q Consensus        20 ~~~~~~PvViwHGlGD   35 (59)
                      .....+|+++.||-=+
T Consensus        88 ~~~~aiPLll~HGWPg  103 (112)
T PF06441_consen   88 KRPNAIPLLLLHGWPG  103 (112)
T ss_dssp             S-TT-EEEEEE--SS-
T ss_pred             CCCCCeEEEEECCCCc
Confidence            3456799999999543


No 59 
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
Probab=35.94  E-value=25  Score=23.92  Aligned_cols=26  Identities=19%  Similarity=0.404  Sum_probs=16.2

Q ss_pred             CcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ..|+|+.||.|.+-.  ....+.+.+.+
T Consensus       131 ~~~vl~~HG~~~~~~--~~~~~~~~l~~  156 (371)
T PRK14875        131 GTPVVLIHGFGGDLN--NWLFNHAALAA  156 (371)
T ss_pred             CCeEEEECCCCCccc--hHHHHHHHHhc
Confidence            478999999886532  34444444443


No 60 
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation .  The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=35.86  E-value=71  Score=22.09  Aligned_cols=23  Identities=9%  Similarity=0.205  Sum_probs=16.0

Q ss_pred             cceeEeeCCCCCCCChhHHHHHH
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTE   47 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~   47 (59)
                      .++|+.||.+++....-...+.+
T Consensus        37 p~vilIHG~~~~~~~~~~~~l~~   59 (275)
T cd00707          37 PTRFIIHGWTSSGEESWISDLRK   59 (275)
T ss_pred             CcEEEEcCCCCCCCCcHHHHHHH
Confidence            46899999998874444555554


No 61 
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 1, TIGR03100) of the same superfamily.
Probab=35.38  E-value=50  Score=23.20  Aligned_cols=25  Identities=12%  Similarity=0.133  Sum_probs=15.8

Q ss_pred             ceeEeeCCCCCCCC--hhHHHHHHHHh
Q 046457           26 PFIVLHGIGDQCSN--QGVKQFTENLS   50 (59)
Q Consensus        26 PvViwHGlGDsC~n--~gm~~~~~ll~   50 (59)
                      ++|+.||.|.+...  ..+..+.+.+.
T Consensus        27 ~VlllHG~g~~~~~~~~~~~~la~~La   53 (266)
T TIGR03101        27 VVIYLPPFAEEMNKSRRMVALQARAFA   53 (266)
T ss_pred             EEEEECCCcccccchhHHHHHHHHHHH
Confidence            36799999976543  24555555554


No 62 
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]
Probab=35.28  E-value=38  Score=24.33  Aligned_cols=22  Identities=23%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHH
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQF   45 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~   45 (59)
                      ..|+|+-||++....+= +|...
T Consensus        59 ~~pivlVhG~~~~~~~~~~~~~~   81 (336)
T COG1075          59 KEPIVLVHGLGGGYGNFLPLDYR   81 (336)
T ss_pred             CceEEEEccCcCCcchhhhhhhh
Confidence            57999999987665543 55554


No 63 
>TIGR03230 lipo_lipase lipoprotein lipase. Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
Probab=34.97  E-value=52  Score=25.25  Aligned_cols=26  Identities=23%  Similarity=0.272  Sum_probs=17.3

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHH
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTEN   48 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~l   48 (59)
                      ..-|+|+.||.+++.... -+.++.+.
T Consensus        40 ~~ptvIlIHG~~~s~~~~~w~~~l~~a   66 (442)
T TIGR03230        40 ETKTFIVIHGWTVTGMFESWVPKLVAA   66 (442)
T ss_pred             CCCeEEEECCCCcCCcchhhHHHHHHH
Confidence            346789999999876433 45555543


No 64 
>PF04155 Ground-like:  Ground-like domain;  InterPro: IPR007284  This group of proteins contain one or more copies of the ground-like domain, which are specific to Caenorhabditis elegans and Caenorhabditis briggsae. It has been proposed that the ground-like domain containing proteins may bind and modulate the activity of Patched-like membrane molecules, reminiscent of the modulating activities of neuropeptides []. 
Probab=34.10  E-value=35  Score=19.52  Aligned_cols=14  Identities=7%  Similarity=0.515  Sum_probs=10.0

Q ss_pred             CCCCCChhHHHHHH
Q 046457           34 GDQCSNQGVKQFTE   47 (59)
Q Consensus        34 GDsC~n~gm~~~~~   47 (59)
                      |..|||+.|.++.+
T Consensus         3 ~~~Cn~~~L~~ii~   16 (76)
T PF04155_consen    3 DNKCNSEELRKIIL   16 (76)
T ss_pred             CCccCCHHHHHHHH
Confidence            56788887766544


No 65 
>PF03295 Pox_TAA1:  Poxvirus trans-activator protein A1 C-terminal;  InterPro: IPR004975 Late transcription factor VLTF-2, acts with RNA polymerase to initiate transcription from late gene promoters [].
Probab=33.15  E-value=41  Score=19.91  Aligned_cols=28  Identities=21%  Similarity=0.501  Sum_probs=21.9

Q ss_pred             cceeEeeCCCCCCCCh-hHHHHHHHHhhccCCceeC
Q 046457           25 IPFIVLHGIGDQCSNQ-GVKQFTENLSSFSGSKGYC   59 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~-gm~~~~~ll~~~~G~yv~c   59 (59)
                      +|+|+       |.+| -+-++...+++.-|+|+.|
T Consensus        18 LPLv~-------Y~~Pe~Vi~iIN~lR~keGvYG~c   46 (63)
T PF03295_consen   18 LPLVF-------YEDPEEVINIINELRNKEGVYGSC   46 (63)
T ss_pred             Eeeee-------ccCHHHHHHHHHHhhhccCceeEE
Confidence            57765       3567 7888888888877999987


No 66 
>PF11997 DUF3492:  Domain of unknown function (DUF3492);  InterPro: IPR022622  This domain is functionally uncharacterised and is found in bacteria, archaea and eukaryotes. It is typically between 259 to 282 amino acids in length. This region is found N-terminal PF00534 from PFAM. There are two conserved sequence motifs: GGVS and EHGIY. 
Probab=31.81  E-value=33  Score=24.18  Aligned_cols=22  Identities=32%  Similarity=0.412  Sum_probs=16.2

Q ss_pred             HHHHHHHcccccCcceeEe-eCC
Q 046457           12 TVLLLFFFPVSRSIPFIVL-HGI   33 (59)
Q Consensus        12 ~~~~~~~~~~~~~~PvViw-HGl   33 (59)
                      ++++.+++.....+|+++| ||+
T Consensus       184 Agl~g~~~k~~~g~P~lLTEHGI  206 (268)
T PF11997_consen  184 AGLLGALAKYRYGRPFLLTEHGI  206 (268)
T ss_pred             HHHHHHHHHHHhCCCEEEecCCc
Confidence            4455566666777999999 895


No 67 
>cd08594 PI-PLCc_eta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta. This family corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2)  to generate two important second messengers in eukaryotic signal transduction cascades,  Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding motif, 
Probab=31.78  E-value=1.1e+02  Score=21.75  Aligned_cols=36  Identities=25%  Similarity=0.421  Sum_probs=28.2

Q ss_pred             HHcccccCcceeEeeCCCCCCCChhHHHHHHHHhhccC
Q 046457           17 FFFPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSG   54 (59)
Q Consensus        17 ~~~~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~G   54 (59)
                      -.+..+++.|+++.  +-+.|+.+.-..+.+.+++..|
T Consensus        81 ~~AF~~s~yPvIlS--lE~Hcs~~qQ~~ma~~l~~~lG  116 (227)
T cd08594          81 KYAFIKNEYPVILS--IENHCSVQQQKKMAQYLKEILG  116 (227)
T ss_pred             HhhccCCCCCEEEE--ecccCCHHHHHHHHHHHHHHHh
Confidence            34556789999997  9999988788888888877653


No 68 
>PRK13604 luxD acyl transferase; Provisional
Probab=31.73  E-value=61  Score=23.74  Aligned_cols=27  Identities=26%  Similarity=0.466  Sum_probs=21.0

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      .+|+.+.||-.|+-..+ ...++.+.+.
T Consensus       202 ~~PvLiIHG~~D~lVp~~~s~~l~e~~~  229 (307)
T PRK13604        202 DIPFIAFTANNDSWVKQSEVIDLLDSIR  229 (307)
T ss_pred             CCCEEEEEcCCCCccCHHHHHHHHHHhc
Confidence            49999999999999987 4446665553


No 69 
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase
Probab=31.68  E-value=59  Score=20.24  Aligned_cols=28  Identities=14%  Similarity=0.280  Sum_probs=19.5

Q ss_pred             cCcceeEeeCCCCCCCChhHHHHHHHHh
Q 046457           23 RSIPFIVLHGIGDQCSNQGVKQFTENLS   50 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~gm~~~~~ll~   50 (59)
                      ...|+.++||--|.........+.+.+.
T Consensus       230 i~~P~lii~G~~D~~~~~~~~~~~~~~~  257 (288)
T TIGR01250       230 IKVPTLLTVGEFDTMTPEAAREMQELIA  257 (288)
T ss_pred             cCCCEEEEecCCCccCHHHHHHHHHhcc
Confidence            3589999999999864335555555543


No 70 
>PF05728 UPF0227:  Uncharacterised protein family (UPF0227);  InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO. One of the members of this family YqiA has been shown to be a esterase []. Other members, which include the Escherichia coli (strain K12) YcfP protein are uncharacterised.
Probab=31.67  E-value=95  Score=20.75  Aligned_cols=27  Identities=11%  Similarity=0.287  Sum_probs=19.2

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      ++..||+.-|-.+.--..+++.+++..
T Consensus         2 ilYlHGF~Ssp~S~Ka~~l~~~~~~~~   28 (187)
T PF05728_consen    2 ILYLHGFNSSPQSFKAQALKQYFAEHG   28 (187)
T ss_pred             eEEecCCCCCCCCHHHHHHHHHHHHhC
Confidence            467899888777776667777776643


No 71 
>PF00561 Abhydrolase_1:  alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases.;  InterPro: IPR000073 The alpha/beta hydrolase fold [] is common to a number of hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is an alpha/beta-sheet (rather than a barrel), containing 8 strands connected by helices []. The enzymes are believed to have diverged from a common ancestor, preserving the arrangement of the catalytic residues. All have a catalytic triad, the elements of which are borne on loops, which are the best conserved structural features of the fold. Esterase (EST) from Pseudomonas putida is a member of the alpha/beta hydrolase fold superfamily of enzymes []. In most of the family members the beta-strands are parallels, but some have an inversion of the first strands, which gives it an antiparallel orientation. The catalytic triad residues are presented on loops. One of these is the nucleophile elbow and is the most conserved feature of the fold. Some other members lack one or all of the catalytic residues. Some members are therefore inactive but others are involved in surface recognition. The ESTHER database [] gathers and annotates all the published information related to gene and protein sequences of this superfamily []. This entry represents fold-1 of alpha/beta hydrolase.; PDB: 2VAT_E 2VAX_C 2VAV_H 2PSJ_A 2PSH_B 2PSE_A 2PSF_A 2PSD_A 2EDA_A 1CIJ_A ....
Probab=31.57  E-value=45  Score=20.28  Aligned_cols=30  Identities=13%  Similarity=0.314  Sum_probs=23.3

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      ...+|+.+.+|..|.-..+ ....+++.+.+
T Consensus       173 ~i~~p~l~i~~~~D~~~p~~~~~~~~~~~~~  203 (230)
T PF00561_consen  173 NIKVPTLIIWGEDDPLVPPESSEQLAKLIPN  203 (230)
T ss_dssp             TTTSEEEEEEETTCSSSHHHHHHHHHHHSTT
T ss_pred             ccCCCeEEEEeCCCCCCCHHHHHHHHHhcCC
Confidence            4679999999999997766 66666666654


No 72 
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A). These genes are preferentially located in the subtelomeric regions of the chromosomes of both P. falciparum and P. yoelii.
Probab=31.45  E-value=56  Score=22.98  Aligned_cols=25  Identities=28%  Similarity=0.577  Sum_probs=19.5

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHHHHH
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQFTEN   48 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~~~l   48 (59)
                      ..|+.+.||-.|...++ +..++.+.
T Consensus       270 ~~P~Lii~G~~D~vv~~~~~~~~~~~  295 (332)
T TIGR01607       270 DIPILFIHSKGDCVCSYEGTVSFYNK  295 (332)
T ss_pred             CCCEEEEEeCCCCccCHHHHHHHHHh
Confidence            58999999999999887 55555443


No 73 
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]
Probab=31.11  E-value=89  Score=24.24  Aligned_cols=28  Identities=14%  Similarity=0.197  Sum_probs=18.9

Q ss_pred             cccCcceeEeeCCCCCCCCh--hHHHHHHH
Q 046457           21 VSRSIPFIVLHGIGDQCSNQ--GVKQFTEN   48 (59)
Q Consensus        21 ~~~~~PvViwHGlGDsC~n~--gm~~~~~l   48 (59)
                      -....|+.+.||..|.=+..  ++.=+..+
T Consensus       548 ~~i~~P~LliHG~~D~~v~~~q~~~~~~aL  577 (620)
T COG1506         548 DNIKTPLLLIHGEEDDRVPIEQAEQLVDAL  577 (620)
T ss_pred             cccCCCEEEEeecCCccCChHHHHHHHHHH
Confidence            34569999999999986643  44433333


No 74 
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed
Probab=30.25  E-value=1.7e+02  Score=20.28  Aligned_cols=35  Identities=9%  Similarity=0.076  Sum_probs=20.8

Q ss_pred             cccCcceeEeeCCCCCCCChhHHHHHHHHhhccCCce
Q 046457           21 VSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKG   57 (59)
Q Consensus        21 ~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~G~yv   57 (59)
                      .+.+.-+.+||+..+..  ..+.++.+..++..|+-|
T Consensus        27 ~~~~~~l~~w~~~~~~~--~~~~~~~~~F~~~~gi~V   61 (396)
T PRK09474         27 KIEEGKLVIWINGDKGY--NGLAEVGKKFEKDTGIKV   61 (396)
T ss_pred             ccCCCeEEEEECCCchh--HHHHHHHHHHHHhhCCEE
Confidence            45568899999742221  256666666665556543


No 75 
>TIGR03611 RutD pyrimidine utilization protein D. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the hydrolase, alpha/beta fold family defined by pfam00067.
Probab=30.24  E-value=64  Score=19.84  Aligned_cols=27  Identities=11%  Similarity=0.129  Sum_probs=19.9

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHH
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENL   49 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll   49 (59)
                      ...|+.++||--|.-+.+ ...++.+.+
T Consensus       197 i~~P~l~i~g~~D~~~~~~~~~~~~~~~  224 (257)
T TIGR03611       197 IQHPVLLIANRDDMLVPYTQSLRLAAAL  224 (257)
T ss_pred             cCccEEEEecCcCcccCHHHHHHHHHhc
Confidence            468999999999998876 444455443


No 76 
>PF06377 Adipokin_hormo:  Adipokinetic hormone;  InterPro: IPR010475 This family consists of several insect adipokinetic hormone as well as the related crustacean red pigment concentrating hormone (RPCH) []. Flight activity of insects comprises one of the most intense biochemical processes known in nature, and therefore provides an attractive model system to study the hormonal regulation of metabolism during physical exercise. In long-distance flying insects, such as the migratory locust, both carbohydrate and lipid reserves are utilised as fuels for sustained flight activity. The mobilisation of these energy stores in Locusta migratoria (Migratory locust) is mediated by three structurally related adipokinetic hormones (AKHs), which are all capable of stimulating the release of both carbohydrates and lipids from the fat body [].; GO: 0005179 hormone activity
Probab=30.02  E-value=55  Score=18.29  Aligned_cols=20  Identities=10%  Similarity=0.252  Sum_probs=16.0

Q ss_pred             CCCCCCCh--hHHHHHHHHhhc
Q 046457           33 IGDQCSNQ--GVKQFTENLSSF   52 (59)
Q Consensus        33 lGDsC~n~--gm~~~~~ll~~~   52 (59)
                      -+|+|.++  .+..+-++|+++
T Consensus        18 ~~~~C~~s~e~l~~iy~~iQ~E   39 (48)
T PF06377_consen   18 RADDCKSSVESLLHIYKLIQNE   39 (48)
T ss_pred             CCCCCCCcHHHHHHHHHHHHHH
Confidence            47999965  888888888865


No 77 
>PRK05855 short chain dehydrogenase; Validated
Probab=29.56  E-value=31  Score=24.86  Aligned_cols=26  Identities=15%  Similarity=0.247  Sum_probs=16.7

Q ss_pred             CcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ..|+|+.||++++  ......+.+.+.+
T Consensus        25 ~~~ivllHG~~~~--~~~w~~~~~~L~~   50 (582)
T PRK05855         25 RPTVVLVHGYPDN--HEVWDGVAPLLAD   50 (582)
T ss_pred             CCeEEEEcCCCch--HHHHHHHHHHhhc
Confidence            4589999999854  2344555555543


No 78 
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=29.46  E-value=59  Score=20.99  Aligned_cols=27  Identities=15%  Similarity=0.047  Sum_probs=19.8

Q ss_pred             cCcceeEeeCCCCCCCChh-HHHHHHHH
Q 046457           23 RSIPFIVLHGIGDQCSNQG-VKQFTENL   49 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~g-m~~~~~ll   49 (59)
                      ...|+.+++|--|.+.++. ..++.+.+
T Consensus       222 i~~Pvlli~G~~D~~v~~~~~~~~~~~~  249 (282)
T TIGR03343       222 IKAKTLVTWGRDDRFVPLDHGLKLLWNM  249 (282)
T ss_pred             CCCCEEEEEccCCCcCCchhHHHHHHhC
Confidence            4589999999999998874 34444444


No 79 
>COG0400 Predicted esterase [General function prediction only]
Probab=29.28  E-value=1.1e+02  Score=20.92  Aligned_cols=32  Identities=19%  Similarity=0.239  Sum_probs=25.5

Q ss_pred             cccCcceeEeeCCCCCCCCh-hHHHHHHHHhhc
Q 046457           21 VSRSIPFIVLHGIGDQCSNQ-GVKQFTENLSSF   52 (59)
Q Consensus        21 ~~~~~PvViwHGlGDsC~n~-gm~~~~~ll~~~   52 (59)
                      ....+|+.+.||-=|.=+.. -..+.++.+++.
T Consensus       143 ~~~~~pill~hG~~Dpvvp~~~~~~l~~~l~~~  175 (207)
T COG0400         143 DLAGTPILLSHGTEDPVVPLALAEALAEYLTAS  175 (207)
T ss_pred             ccCCCeEEEeccCcCCccCHHHHHHHHHHHHHc
Confidence            45559999999999986655 778888888874


No 80 
>PRK10778 dksA RNA polymerase-binding transcription factor; Provisional
Probab=29.23  E-value=42  Score=22.16  Aligned_cols=17  Identities=29%  Similarity=0.669  Sum_probs=12.0

Q ss_pred             HHHHHHHhhcc-CCceeC
Q 046457           43 KQFTENLSSFS-GSKGYC   59 (59)
Q Consensus        43 ~~~~~ll~~~~-G~yv~c   59 (59)
                      ..|.+-|++.- |+|++|
T Consensus        97 ~~I~~AL~Ri~~gtYG~C  114 (151)
T PRK10778         97 KKIEKTLKKVEDEDFGYC  114 (151)
T ss_pred             HHHHHHHHHHhCCCCcee
Confidence            45555566655 999998


No 81 
>PF01713 Smr:  Smr domain;  InterPro: IPR002625 This family includes the Smr (Small MutS Related) proteins, and the C-terminal region of the MutS2 protein. It has been suggested that this domain interacts with the MutS1 (P23909 from SWISSPROT) protein in the case of Smr proteins and with the N-terminal MutS related region of MutS2, P94545 from SWISSPROT [].; PDB: 3QD7_X 2D9I_A 3FAU_A 2VKC_A 2ZQE_A.
Probab=29.18  E-value=66  Score=18.11  Aligned_cols=30  Identities=17%  Similarity=0.328  Sum_probs=17.3

Q ss_pred             cccCcceeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           21 VSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        21 ~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      ......+.+.||.|.. +..|.  +++.++++.
T Consensus        24 ~~~~~~~~II~G~G~h-S~~g~--Lk~~V~~~L   53 (83)
T PF01713_consen   24 QRGIRELRIITGKGNH-SKGGV--LKRAVRRWL   53 (83)
T ss_dssp             HTTHSEEEEE--STCT-CCTSH--HHHHHHHHH
T ss_pred             HcCCCEEEEEeccCCC-CCCCc--HHHHHHHHH
Confidence            3445889999999933 22243  777666654


No 82 
>TIGR03299 LGT_TIGR03299 phage/plasmid-related protein TIGR03299. Members of this uncharacterized protein family are found in various Mycobacterium phage genomes, in Streptomyces coelicolor plasmid SCP1, and in bacterial genomes near various markers that suggest lateral gene transfer. The function is unknown.
Probab=28.92  E-value=21  Score=26.25  Aligned_cols=18  Identities=17%  Similarity=0.612  Sum_probs=11.6

Q ss_pred             eeCCCCCCCCh-hHHHHHH
Q 046457           30 LHGIGDQCSNQ-GVKQFTE   47 (59)
Q Consensus        30 wHGlGDsC~n~-gm~~~~~   47 (59)
                      |||+|-.-..+ ......+
T Consensus        11 WHgLG~~l~~~~~~e~~~~   29 (309)
T TIGR03299        11 WHGLGNHLPGRQPIDDWAR   29 (309)
T ss_pred             cccCCccCCCCCCHHHHHH
Confidence            99999877543 5444443


No 83 
>PRK00923 sirohydrochlorin cobaltochelatase; Reviewed
Probab=28.54  E-value=67  Score=19.44  Aligned_cols=27  Identities=19%  Similarity=0.244  Sum_probs=20.2

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      +++-||--|.-.|..+.++.+.+++..
T Consensus         5 vlv~hGS~~~~~~~~~~~~~~~l~~~~   31 (126)
T PRK00923          5 LLVGHGSRLPYNKEVVTKIAEKIKEKH   31 (126)
T ss_pred             EEEeCCCCChHHHHHHHHHHHHHHHhC
Confidence            456688888766778888888887754


No 84 
>PLN02652 hydrolase; alpha/beta fold family protein
Probab=27.06  E-value=72  Score=23.45  Aligned_cols=26  Identities=27%  Similarity=0.691  Sum_probs=20.3

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHHHHHH
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQFTENL   49 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~~~ll   49 (59)
                      .+|+.++||-.|.-..+ ...++.+.+
T Consensus       324 ~vPvLIi~G~~D~vvp~~~a~~l~~~~  350 (395)
T PLN02652        324 TVPFMVLHGTADRVTDPLASQDLYNEA  350 (395)
T ss_pred             CCCEEEEEeCCCCCCCHHHHHHHHHhc
Confidence            59999999999999976 555554443


No 85 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=27.03  E-value=49  Score=20.24  Aligned_cols=16  Identities=38%  Similarity=0.864  Sum_probs=10.3

Q ss_pred             HHHHHHhhcc-CCceeC
Q 046457           44 QFTENLSSFS-GSKGYC   59 (59)
Q Consensus        44 ~~~~ll~~~~-G~yv~c   59 (59)
                      .+..-++..- |+|++|
T Consensus        67 ~i~~AL~ri~~g~yG~C   83 (110)
T TIGR02420        67 KIDEALKRIEDGEYGYC   83 (110)
T ss_pred             HHHHHHHHHhCCCCCch
Confidence            4444455554 999998


No 86 
>PRK05634 nucleosidase; Provisional
Probab=26.90  E-value=64  Score=21.38  Aligned_cols=35  Identities=9%  Similarity=0.248  Sum_probs=26.3

Q ss_pred             HHcccccCcceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           17 FFFPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        17 ~~~~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      ..+.....+|++....+.|.+....-..+++.+++
T Consensus       138 a~va~~~~vPf~~iR~ISD~a~~~~~~~~~~~~~~  172 (185)
T PRK05634        138 AAVAAEFGVPCRLVKHVSDSADESALGSWPEAVDA  172 (185)
T ss_pred             HHHHHHhCCCEEEEEEeccCCCCcccccHHHHHHH
Confidence            34445667999999999999997766667765543


No 87 
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate.
Probab=26.79  E-value=80  Score=19.03  Aligned_cols=28  Identities=14%  Similarity=0.298  Sum_probs=20.3

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      .+.|+.++||--|.-..+ ...++.+.+.
T Consensus       192 ~~~Pvlii~g~~D~~~~~~~~~~~~~~~~  220 (251)
T TIGR02427       192 IAVPTLCIAGDQDGSTPPELVREIADLVP  220 (251)
T ss_pred             cCCCeEEEEeccCCcCChHHHHHHHHhCC
Confidence            358999999998887766 5555555544


No 88 
>PF07819 PGAP1:  PGAP1-like protein;  InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0006505 GPI anchor metabolic process, 0006886 intracellular protein transport, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=26.13  E-value=60  Score=21.98  Aligned_cols=23  Identities=17%  Similarity=0.391  Sum_probs=16.1

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHH
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQ   44 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~   44 (59)
                      ....|+++.||.+-++..- ++++
T Consensus         2 ~~g~pVlFIhG~~Gs~~q~rsl~~   25 (225)
T PF07819_consen    2 LSGIPVLFIHGNAGSYKQVRSLAS   25 (225)
T ss_pred             CCCCEEEEECcCCCCHhHHHHHHH
Confidence            3568999999987776633 4443


No 89 
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]
Probab=26.07  E-value=46  Score=25.74  Aligned_cols=23  Identities=26%  Similarity=0.504  Sum_probs=15.2

Q ss_pred             HHcccccCcceeEeeCCCCCCCCh-hH
Q 046457           17 FFFPVSRSIPFIVLHGIGDQCSNQ-GV   42 (59)
Q Consensus        17 ~~~~~~~~~PvViwHGlGDsC~n~-gm   42 (59)
                      ..+..+...-+|++||   -|.|| |.
T Consensus       164 a~L~~a~~~~vvLLH~---CcHNPTG~  187 (396)
T COG1448         164 ADLKTAPEGSVVLLHG---CCHNPTGI  187 (396)
T ss_pred             HHHHhCCCCCEEEEec---CCCCCCCC
Confidence            4445556667999998   23388 65


No 90 
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase. This family describes homoserine-O-acetyltransferase, an enzyme of methionine biosynthesis. This model has been rebuilt to identify sequences more broadly, including a number of sequences suggested to be homoserine O-acetyltransferase based on proximity to other Met biosynthesis genes.
Probab=25.89  E-value=1e+02  Score=21.44  Aligned_cols=28  Identities=18%  Similarity=0.302  Sum_probs=23.6

Q ss_pred             CcceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           24 SIPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      +.|+.+.||-.|.-..+ .+.++.+.+.+
T Consensus       288 ~~P~Lvi~G~~D~~~p~~~~~~~a~~i~~  316 (351)
T TIGR01392       288 KAPFLVVSITSDWLFPPAESRELAKALPA  316 (351)
T ss_pred             CCCEEEEEeCCccccCHHHHHHHHHHHhh
Confidence            47999999999997777 78888888865


No 91 
>PF01918 Alba:  Alba;  InterPro: IPR002775  Members of this family include the archaeal protein Alba and a number of eukaryotic proteins with no known function. The DNA/RNA-binding protein Alba binds double-stranded DNA tightly but without sequence specificity. It binds rRNA and mRNA in vivo, and may play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes. It is distributed uniformly and abundantly on the chromosome. Alba has been shown to bind DNA and affect DNA supercoiling in a temperature dependent manner []. It is regulated by acetylation (alba = acetylation lowers binding affinity) by the Sir2 protein. Alba is proposed to play a role in establishment or maintenance of chromatin architecture and thereby in transcription repression. For further information see [].; GO: 0003676 nucleic acid binding; PDB: 3TOE_B 3IAB_A 1NFJ_A 1NFH_B 2Q3V_B 1VM0_B 1NH9_A 1Y9X_A 3U6Y_C 2H9U_A ....
Probab=25.77  E-value=38  Score=18.70  Aligned_cols=32  Identities=22%  Similarity=0.102  Sum_probs=21.0

Q ss_pred             ccccCcceeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           20 PVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        20 ~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      ......+.|.+||+|..-+  -.-.+.+++++..
T Consensus        25 ~~~~~~~~V~l~g~G~aI~--kaI~vaei~K~~~   56 (70)
T PF01918_consen   25 RENGKNDEVVLKGRGKAIS--KAISVAEILKRRF   56 (70)
T ss_dssp             TTHTTCSEEEEEEECCHHH--HHHHHHHHHHHHT
T ss_pred             hhcCCCCEEEEEEEcHHHH--HHHHHHHHHHHhh
Confidence            4456688999999996543  3445555665553


No 92 
>PRK06026 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Validated
Probab=25.56  E-value=78  Score=21.98  Aligned_cols=34  Identities=29%  Similarity=0.342  Sum_probs=24.4

Q ss_pred             HcccccCcceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           18 FFPVSRSIPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        18 ~~~~~~~~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      .+.....+|++....+.|.+... .+..+.+.+++
T Consensus       155 qVc~~~~vPfl~iR~ISD~a~~~a~~~df~~f~~~  189 (212)
T PRK06026        155 RACQAFGVPLIGLRGISDGAAELKHVGDWTEYLHV  189 (212)
T ss_pred             HHHHHcCCCEEEEEEEecCCCcccchhhHHHHHHH
Confidence            34456779999999999998754 65555555543


No 93 
>PF00151 Lipase:  Lipase;  InterPro: IPR013818 Triglyceride lipases (3.1.1.3 from EC) are lipolytic enzymes that hydrolyse ester linkages of triglycerides []. Lipases are widely distributed in animals, plants and prokaryotes. At least three tissue-specific isozymes exist in higher vertebrates, pancreatic, hepatic and gastric/lingual. These lipases are closely related to each other and to lipoprotein lipase (3.1.1.34 from EC), which hydrolyses triglycerides of chylomicrons and very low density lipoproteins (VLDL) []. The most conserved region in all these proteins is centred around a serine residue which has been shown [] to participate, with an histidine and an aspartic acid residue, in a charge relay system. Such a region is also present in lipases of prokaryotic origin and in lecithin-cholesterol acyltransferase (2.3.1.43 from EC) (LCAT) [], which catalyzes fatty acid transfer between phosphatidylcholine and cholesterol.; PDB: 1LPB_B 1LPA_B 1N8S_A 1GPL_A 1W52_X 2PVS_B 2OXE_B 1BU8_A 2PPL_A 1ETH_A ....
Probab=25.26  E-value=92  Score=22.60  Aligned_cols=26  Identities=27%  Similarity=0.468  Sum_probs=16.0

Q ss_pred             Ccc-eeEeeCCCCCC-CChhHHHHHHHH
Q 046457           24 SIP-FIVLHGIGDQC-SNQGVKQFTENL   49 (59)
Q Consensus        24 ~~P-vViwHGlGDsC-~n~gm~~~~~ll   49 (59)
                      +.| +|+.||-.|++ ..+.+..+++.+
T Consensus        70 ~~pt~iiiHGw~~~~~~~~~~~~~~~al   97 (331)
T PF00151_consen   70 SKPTVIIIHGWTGSGSSESWIQDMIKAL   97 (331)
T ss_dssp             TSEEEEEE--TT-TT-TTTHHHHHHHHH
T ss_pred             CCCeEEEEcCcCCcccchhHHHHHHHHH
Confidence            344 56789999999 566787777744


No 94 
>PLN02894 hydrolase, alpha/beta fold family protein
Probab=24.91  E-value=42  Score=24.38  Aligned_cols=12  Identities=25%  Similarity=0.678  Sum_probs=10.0

Q ss_pred             cceeEeeCCCCC
Q 046457           25 IPFIVLHGIGDQ   36 (59)
Q Consensus        25 ~PvViwHGlGDs   36 (59)
                      .|+|+.||.|.+
T Consensus       106 p~vvllHG~~~~  117 (402)
T PLN02894        106 PTLVMVHGYGAS  117 (402)
T ss_pred             CEEEEECCCCcc
Confidence            679999999854


No 95 
>PLN02578 hydrolase
Probab=24.26  E-value=86  Score=21.97  Aligned_cols=29  Identities=17%  Similarity=0.209  Sum_probs=21.5

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHHhh
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENLSS   51 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll~~   51 (59)
                      .+.|+.+.||-.|....+ ...++++.+.+
T Consensus       295 i~~PvLiI~G~~D~~v~~~~~~~l~~~~p~  324 (354)
T PLN02578        295 LSCPLLLLWGDLDPWVGPAKAEKIKAFYPD  324 (354)
T ss_pred             CCCCEEEEEeCCCCCCCHHHHHHHHHhCCC
Confidence            469999999999987755 55556665543


No 96 
>cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation. Tubulin is the major component of microtubules, but also exists as a heterodimer and as a curved oligomer. Microtubules exist in all eukaryotic cells and are responsible for many functions, including cellular transport, cell motility, and mitosis.  FtsZ forms a ring-shaped septum at the site of bacterial cell division, which is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ can polymerize into tubes, sheets, and rings in vitro and is ubiquitous in eubacteria, archaea, and chloroplasts.
Probab=23.81  E-value=1.1e+02  Score=21.47  Aligned_cols=27  Identities=19%  Similarity=0.249  Sum_probs=19.1

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      +.+.||||+-.-+.--..+.+.+++++
T Consensus        92 f~i~~slgGGTGsG~~~~i~e~l~d~y  118 (328)
T cd00286          92 FFITHSLGGGTGSGLGPVLAERLKDEY  118 (328)
T ss_pred             eEEEeecCCCccccHHHHHHHHHHHHc
Confidence            788999998644433345778888876


No 97 
>PF06028 DUF915:  Alpha/beta hydrolase of unknown function (DUF915);  InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like.; PDB: 3LP5_A 3FLE_A 3DS8_A.
Probab=23.75  E-value=62  Score=22.80  Aligned_cols=27  Identities=22%  Similarity=0.493  Sum_probs=15.2

Q ss_pred             ccCcceeEeeCCCCCCCChhHHHHHHHHh
Q 046457           22 SRSIPFIVLHGIGDQCSNQGVKQFTENLS   50 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~gm~~~~~ll~   50 (59)
                      .+.+|.++.||-|-+-.+.  ..+.+-++
T Consensus         9 ~~~tPTifihG~~gt~~s~--~~mi~~~~   35 (255)
T PF06028_consen    9 QSTTPTIFIHGYGGTANSF--NHMINRLE   35 (255)
T ss_dssp             -S-EEEEEE--TTGGCCCC--HHHHHHHH
T ss_pred             cCCCcEEEECCCCCChhHH--HHHHHHHH
Confidence            4569999999998775543  34444444


No 98 
>PLN02511 hydrolase
Probab=23.67  E-value=1.2e+02  Score=21.96  Aligned_cols=21  Identities=19%  Similarity=0.365  Sum_probs=12.6

Q ss_pred             ceeEeeCCCCCCCChhHHHHH
Q 046457           26 PFIVLHGIGDQCSNQGVKQFT   46 (59)
Q Consensus        26 PvViwHGlGDsC~n~gm~~~~   46 (59)
                      ++|+.||++-+..+.-+..+.
T Consensus       102 ~vvllHG~~g~s~~~y~~~~~  122 (388)
T PLN02511        102 VLILLPGLTGGSDDSYVRHML  122 (388)
T ss_pred             EEEEECCCCCCCCCHHHHHHH
Confidence            499999995543333344443


No 99 
>PF15001 AP-5_subunit_s1:  AP-5 complex subunit sigma-1
Probab=23.60  E-value=50  Score=22.94  Aligned_cols=12  Identities=33%  Similarity=0.800  Sum_probs=10.0

Q ss_pred             eeEeeCCCCCCC
Q 046457           27 FIVLHGIGDQCS   38 (59)
Q Consensus        27 vViwHGlGDsC~   38 (59)
                      +|+|+|.|+-|.
T Consensus       105 ~vvW~~v~~l~f  116 (189)
T PF15001_consen  105 IVVWLGVGSLCF  116 (189)
T ss_pred             EEEeeccCCEEE
Confidence            899999987663


No 100
>PF03583 LIP:  Secretory lipase ;  InterPro: IPR005152 This entry represents a family of secreted lipases. Family members include the LIP lipases from Candida albicans, which are expressed and secreted during the infection cycle of these pathogens [].; GO: 0004806 triglyceride lipase activity, 0016042 lipid catabolic process
Probab=23.41  E-value=57  Score=22.88  Aligned_cols=27  Identities=11%  Similarity=0.397  Sum_probs=18.4

Q ss_pred             CcceeEeeCCCCCCCChhHHHHHHHHhhc
Q 046457           24 SIPFIVLHGIGDQCSNQGVKQFTENLSSF   52 (59)
Q Consensus        24 ~~PvViwHGlGDsC~n~gm~~~~~ll~~~   52 (59)
                      ..|+.++||..|.=...  ....++.+++
T Consensus       219 ~~Pv~i~~g~~D~vvP~--~~~~~l~~~~  245 (290)
T PF03583_consen  219 TVPVLIYQGTADEVVPP--ADTDALVAKW  245 (290)
T ss_pred             CCCEEEEecCCCCCCCh--HHHHHHHHHH
Confidence            49999999999985533  3444455544


No 101
>PF08874 DUF1835:  Domain of unknown function (DUF1835);  InterPro: IPR014973 This group of proteins are functionally uncharacterised. 
Probab=23.41  E-value=72  Score=19.17  Aligned_cols=35  Identities=11%  Similarity=0.136  Sum_probs=24.8

Q ss_pred             ccCcceeEeeCCCCCCCChhHHHHHHHHhhcc-CCce
Q 046457           22 SRSIPFIVLHGIGDQCSNQGVKQFTENLSSFS-GSKG   57 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~-G~yv   57 (59)
                      ....|+++|.|= |....-||..+-..|++.. .+|+
T Consensus        84 ~~~~~I~iW~~~-~~~dq~gl~~~l~~L~~~~~~I~~  119 (124)
T PF08874_consen   84 PEDDPIVIWYGD-NAYDQLGLRYLLSLLKDKPNRIYV  119 (124)
T ss_pred             CCCCEEEEEeCC-CHHHHHHHHHHHHHhcCCCCeEEE
Confidence            344599999863 4444449999999998876 5554


No 102
>cd08633 PI-PLCc_eta2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta2. This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozyme 2. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2)  to generate two important second messengers in eukaryotic signal transduction cascades,  Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding m
Probab=23.22  E-value=1.8e+02  Score=21.02  Aligned_cols=35  Identities=20%  Similarity=0.356  Sum_probs=26.7

Q ss_pred             HHcccccCcceeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           17 FFFPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        17 ~~~~~~~~~PvViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      -.+..+++.|+++.  |-+.|+.+.=..+.+++++..
T Consensus        81 ~~AF~~s~yPvIls--lE~Hcs~~qQ~~ma~~l~~~l  115 (254)
T cd08633          81 KYAFIKNEYPVILS--IENHCSVPQQKKMAQYLTEIL  115 (254)
T ss_pred             HHhccCCCCCEEEE--ecccCCHHHHHHHHHHHHHHH
Confidence            34556788999986  899998777777777777755


No 103
>COG5157 CDC73 RNA polymerase II assessory factor [Transcription]
Probab=23.14  E-value=59  Score=24.76  Aligned_cols=28  Identities=21%  Similarity=0.289  Sum_probs=22.3

Q ss_pred             cceeEeeCCCCCCCCh-hHHHHHHHHhhccCCce
Q 046457           25 IPFIVLHGIGDQCSNQ-GVKQFTENLSSFSGSKG   57 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~-gm~~~~~ll~~~~G~yv   57 (59)
                      -|+++.   --+.+++ .|.++||.+++  |.||
T Consensus       205 DPIIlv---p~saSS~lt~~NIK~FleE--gkyV  233 (362)
T COG5157         205 DPIILV---PQSASSPLTLSNIKEFLEE--GKYV  233 (362)
T ss_pred             CceEEe---ccccccceeHHHHHHHHHh--cCcc
Confidence            567664   4566777 99999999999  8887


No 104
>PLN02442 S-formylglutathione hydrolase
Probab=23.09  E-value=1.4e+02  Score=20.52  Aligned_cols=29  Identities=17%  Similarity=0.214  Sum_probs=21.3

Q ss_pred             cCcceeEeeCCCCCCCCh--hHHHHHHHHhh
Q 046457           23 RSIPFIVLHGIGDQCSNQ--GVKQFTENLSS   51 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~--gm~~~~~ll~~   51 (59)
                      ..+|+.++||=-|..+..  .-..+.+.+++
T Consensus       216 ~~~pvli~~G~~D~~v~~~~~s~~~~~~l~~  246 (283)
T PLN02442        216 VSATILIDQGEADKFLKEQLLPENFEEACKE  246 (283)
T ss_pred             cCCCEEEEECCCCccccccccHHHHHHHHHH
Confidence            468999999999987664  24566666654


No 105
>cd03414 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), C-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both CbiX and SirB are found in a wide range of bacteria.
Probab=22.91  E-value=95  Score=18.27  Aligned_cols=27  Identities=22%  Similarity=0.224  Sum_probs=18.6

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      +++-||--|.=.+..+.++.+.+++..
T Consensus         4 llv~HGS~~~~~~~~~~~l~~~l~~~~   30 (117)
T cd03414           4 VLVGRGSSDPDANADVAKIARLLEEGT   30 (117)
T ss_pred             EEEcCCCCCHHHHHHHHHHHHHHHHhc
Confidence            456688776655667777887777655


No 106
>cd03064 TRX_Fd_NuoE TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily; Nuo, also called respiratory chain Complex 1, is the entry point for electrons into the respiratory chains of bacteria and the mitochondria of eukaryotes. It is a multisubunit complex with at least 14 core subunits. It catalyzes the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane, providing the proton motive force required for energy-consuming processes. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE core subunit, also called the 24 kD subunit of Complex 1. This subfamily also include formate dehydrogenases, NiFe hydrogenases and NAD-reducing hydrogenases, that contain a NuoE domain. A subset of these proteins contain both NuoE and NuoF in a single chain. NuoF, also called the 51 kD subunit of Complex 1, contains one [4Fe-4S] clu
Probab=22.31  E-value=87  Score=17.55  Aligned_cols=25  Identities=12%  Similarity=0.259  Sum_probs=18.3

Q ss_pred             cceeEeeCCCCCCCChhHHHHHHHHhh
Q 046457           25 IPFIVLHGIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        25 ~PvViwHGlGDsC~n~gm~~~~~ll~~   51 (59)
                      =|+|+++  |.-|.+-.-.++.+++++
T Consensus        55 gP~v~v~--g~~y~~vt~~~i~~i~~~   79 (80)
T cd03064          55 APVMMIN--DDVYGRLTPEKVDAILEA   79 (80)
T ss_pred             CCEEEEC--CEEECCCCHHHHHHHHHh
Confidence            6888887  456766666788887765


No 107
>PF10216 ChpXY:  CO2 hydration protein (ChpXY);  InterPro: IPR010220 This small family of proteins includes paralogs ChpX and ChpY in Synechococcus sp. (strain PCC 7942) (Anacystis nidulans R2) and other cyanobacteria, associated with distinct NAD(P)H dehydrogenase complexes. These proteins collectively enable light-dependent CO2 hydration and CO2 uptake; loss of both blocks growth at low CO2 concentrations.
Probab=22.31  E-value=50  Score=25.21  Aligned_cols=14  Identities=29%  Similarity=0.484  Sum_probs=10.2

Q ss_pred             eeEeeCCC--CCCCCh
Q 046457           27 FIVLHGIG--DQCSNQ   40 (59)
Q Consensus        27 vViwHGlG--DsC~n~   40 (59)
                      -.+|||-|  |.+-++
T Consensus        87 aM~WHggGglD~YLDs  102 (353)
T PF10216_consen   87 AMLWHGGGGLDAYLDS  102 (353)
T ss_pred             HhhccCCCCcccccCC
Confidence            36899988  777654


No 108
>PF01738 DLH:  Dienelactone hydrolase family;  InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway. Enzymes induced in 4-fluorobenzoate-utilizing bacteria have been classified into three groups on the basis of their specificity towards cis- and trans-dienelactone []. Some proteins contain repeated small fragments of this domain (for example rat kan-1 protein).; GO: 0016787 hydrolase activity; PDB: 1GGV_A 1ZIY_A 1ZI6_A 1ZIC_A 1ZJ5_A 1ZI8_A 1ZJ4_A 1ZI9_A 1ZIX_A 3F67_A.
Probab=22.28  E-value=1.3e+02  Score=19.24  Aligned_cols=31  Identities=23%  Similarity=0.327  Sum_probs=20.7

Q ss_pred             ccCcceeEeeCCCCCCCCh-hHHHHHHHHhhc
Q 046457           22 SRSIPFIVLHGIGDQCSNQ-GVKQFTENLSSF   52 (59)
Q Consensus        22 ~~~~PvViwHGlGDsC~n~-gm~~~~~ll~~~   52 (59)
                      ..+.|+.+.||--|.-..+ ...++.+.+++.
T Consensus       143 ~~~~P~l~~~g~~D~~~~~~~~~~~~~~l~~~  174 (218)
T PF01738_consen  143 KIKAPVLILFGENDPFFPPEEVEALEEALKAA  174 (218)
T ss_dssp             G--S-EEEEEETT-TTS-HHHHHHHHHHHHCT
T ss_pred             ccCCCEeecCccCCCCCChHHHHHHHHHHHhc
Confidence            3458999999999998877 678888888543


No 109
>PF00091 Tubulin:  Tubulin/FtsZ family, GTPase domain;  InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins. These proteins are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ and tubulin are GTPases, this entry is the GTPase domain. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea.; GO: 0051258 protein polymerization, 0043234 protein complex; PDB: 3E22_B 1SA1_D 3DU7_B 2P4N_B 3DCO_B 1Z2B_D 1SA0_B 2XRP_C 1TVK_B 2BTQ_B ....
Probab=21.97  E-value=77  Score=21.07  Aligned_cols=31  Identities=19%  Similarity=0.341  Sum_probs=21.8

Q ss_pred             eeEeeCCCCCCCChhH-HHHHHHHhhcc-CCcee
Q 046457           27 FIVLHGIGDQCSNQGV-KQFTENLSSFS-GSKGY   58 (59)
Q Consensus        27 vViwHGlGDsC~n~gm-~~~~~ll~~~~-G~yv~   58 (59)
                      +++.||||.- ..+|+ -.+.+.+++.+ +.++.
T Consensus       127 ~~i~~slgGG-TGSG~~~~l~~~l~~~y~~~~~~  159 (216)
T PF00091_consen  127 FFIVHSLGGG-TGSGLGPVLAEMLREEYPKKPII  159 (216)
T ss_dssp             EEEEEESSSS-HHHHHHHHHHHHHHHTSTTSEEE
T ss_pred             ceecccccce-eccccccccchhhhcccccccee
Confidence            7889999976 33344 47888888887 66553


No 110
>PF07521 RMMBL:  RNA-metabolising metallo-beta-lactamase;  InterPro: IPR011108 The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 from INTERPRO and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in RNA metabolism [].; PDB: 3ZQ4_D 2I7T_A 2I7V_A 2YCB_B 3BK1_A 3T3N_A 3BK2_A 3T3O_A 3AF5_A 3AF6_A ....
Probab=21.88  E-value=54  Score=16.96  Aligned_cols=15  Identities=27%  Similarity=0.487  Sum_probs=10.5

Q ss_pred             HcccccCcceeEeeC
Q 046457           18 FFPVSRSIPFIVLHG   32 (59)
Q Consensus        18 ~~~~~~~~PvViwHG   32 (59)
                      ++....|.-+++.||
T Consensus        26 ~i~~~~p~~vilVHG   40 (43)
T PF07521_consen   26 FIEQLNPRKVILVHG   40 (43)
T ss_dssp             HHHHHCSSEEEEESS
T ss_pred             HHHhcCCCEEEEecC
Confidence            344446688889998


No 111
>PF14492 EFG_II:  Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H ....
Probab=21.80  E-value=88  Score=17.75  Aligned_cols=27  Identities=22%  Similarity=0.356  Sum_probs=20.3

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhccCCce
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFSGSKG   57 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~G~yv   57 (59)
                      =.+.+|+|+-    -+.-+.+.|++.+|+-+
T Consensus        45 e~~l~g~Gel----hlev~~~~L~~~~~v~v   71 (75)
T PF14492_consen   45 ELILSGMGEL----HLEVLLERLKRRFGVEV   71 (75)
T ss_dssp             EEEEEESSHH----HHHHHHHHHHHTTCEBE
T ss_pred             eEEEEECCHH----HHHHHHHHHHHHHCCee
Confidence            4677899965    68888888888876644


No 112
>PRK11143 glpQ glycerophosphodiester phosphodiesterase; Provisional
Probab=21.71  E-value=3.1e+02  Score=20.14  Aligned_cols=34  Identities=6%  Similarity=0.078  Sum_probs=23.5

Q ss_pred             HcccccCcceeEee-CCCCCCCChhHHHHHHHHhh
Q 046457           18 FFPVSRSIPFIVLH-GIGDQCSNQGVKQFTENLSS   51 (59)
Q Consensus        18 ~~~~~~~~PvViwH-GlGDsC~n~gm~~~~~ll~~   51 (59)
                      .++.....|.|+-| |-....---++.+|++-++.
T Consensus        19 ~~~~~~~~pliiAHRGas~~~PENTl~Af~~A~~~   53 (355)
T PRK11143         19 AAAADSAEKIVIAHRGASGYLPEHTLPAKAMAYAQ   53 (355)
T ss_pred             HhhhcCCCcEEEECCCCCCCCCcchHHHHHHHHHc
Confidence            34456779999999 64322221189999999886


No 113
>cd00247 Endostatin-like Endostatin-like domain; the angiogenesis inhibitor endostatin is a C-terminal fragment of collagen XV/XVIII, a proteoglycan/collagen found in vessel walls and basement membranes; this domain has a compact globular fold similar to that of C-type lectins; endostatin XVIII is monomeric and contains a heparin-binding epitope and zinc binding sites while endostatin XV is trimeric and contains neither of these sites; the generation of endostatin or endostatin-like collagen XV/XVIII fragments is catalyzed by proteolytic enzymes within the protease-sensitive hinge region of the C-terminal domain; endostatin inhibits endothelial cell migration in vitro and appears to be highly effective in murine in vivo studies
Probab=21.69  E-value=40  Score=23.35  Aligned_cols=12  Identities=33%  Similarity=0.692  Sum_probs=9.0

Q ss_pred             eEeeC-------CCCCCCC
Q 046457           28 IVLHG-------IGDQCSN   39 (59)
Q Consensus        28 ViwHG-------lGDsC~n   39 (59)
                      .+|||       +.|++|.
T Consensus       112 ~vWHGS~~~G~r~~~~yC~  130 (171)
T cd00247         112 MVWHGSDPNGRRLTDSYCE  130 (171)
T ss_pred             eeEecCCCCCcChhhchhh
Confidence            68999       4677774


No 114
>TIGR01705 MTA/SAH-nuc-hyp 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, putative. This enzyme is involved in the recycling of the components of S-adenosylmethionine after it has donated one of its two non-ribose sulfur ligands to an acceptor. In the case of 5'-methylthioadenosine this represents the first step of the methionine salvage pathway in bacteria. This enzyme is widely distributed in bacteria.
Probab=21.45  E-value=1.1e+02  Score=21.34  Aligned_cols=33  Identities=27%  Similarity=0.354  Sum_probs=23.1

Q ss_pred             HcccccCcceeEeeCCCCCCCC-hhHHHHHHHHh
Q 046457           18 FFPVSRSIPFIVLHGIGDQCSN-QGVKQFTENLS   50 (59)
Q Consensus        18 ~~~~~~~~PvViwHGlGDsC~n-~gm~~~~~ll~   50 (59)
                      .+.....+|++....+.|..+. .++..+.+.++
T Consensus       155 ~vc~~~~vpf~~iR~ISD~a~~~~~~~df~~f~~  188 (212)
T TIGR01705       155 RACQLFDVPLIGLRGISDGAADLNHVDDWTAYLD  188 (212)
T ss_pred             HHHHHcCCCEEEEEEEecCCCCccchhhHHHHHH
Confidence            3445677999999999998654 46555555554


No 115
>cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa. The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly.  The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes. The alpha/beta-tubulin heterodimer is the structural subunit of microtubules.  The alpha- and beta-tubulins share 40% amino-acid sequence identity, exist in several isotype forms, and undergo a variety of posttranslational modifications.  The structures of alpha- and beta-tubulin are basically identical: each monomer is formed by a core of two beta-sheets surrounded by alpha-helices. The monomer structure is very compact, but can be divided into three regions based on function: the amino-termi
Probab=20.90  E-value=1.3e+02  Score=21.86  Aligned_cols=27  Identities=22%  Similarity=0.182  Sum_probs=19.4

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      +.+.|+||+-.-+.--..+.+.|++++
T Consensus        92 f~i~~sl~GGTGSG~gs~l~e~l~d~y  118 (382)
T cd06059          92 FQITHSLGGGTGSGLGSLLLELLSDEY  118 (382)
T ss_pred             eEEEEecCCCcchhHHHHHHHHHHHhc
Confidence            688999998654443356778888876


No 116
>PLN02965 Probable pheophorbidase
Probab=20.40  E-value=1.2e+02  Score=19.68  Aligned_cols=28  Identities=14%  Similarity=0.224  Sum_probs=21.0

Q ss_pred             cCcceeEeeCCCCCCCCh-hHHHHHHHHh
Q 046457           23 RSIPFIVLHGIGDQCSNQ-GVKQFTENLS   50 (59)
Q Consensus        23 ~~~PvViwHGlGDsC~n~-gm~~~~~ll~   50 (59)
                      .++|..+.+|-.|....+ ....+.+.+.
T Consensus       192 i~vP~lvi~g~~D~~~~~~~~~~~~~~~~  220 (255)
T PLN02965        192 EKVPRVYIKTAKDNLFDPVRQDVMVENWP  220 (255)
T ss_pred             CCCCEEEEEcCCCCCCCHHHHHHHHHhCC
Confidence            569999999999999988 4444444443


No 117
>TIGR02890 spore_yteA sporulation protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to PFAM family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. The function of proteins in this family is unknown. YteA was detected in mature spores of Bacillus subtilis by Kuwana, et al., and appears to be expressed under control of sigma-K.
Probab=20.18  E-value=78  Score=21.04  Aligned_cols=18  Identities=22%  Similarity=0.669  Sum_probs=11.3

Q ss_pred             HHHHHHHHhhcc-CCceeC
Q 046457           42 VKQFTENLSSFS-GSKGYC   59 (59)
Q Consensus        42 m~~~~~ll~~~~-G~yv~c   59 (59)
                      +..|.+-|++.- |.|++|
T Consensus        71 L~~Ie~AL~Ri~~G~YG~C   89 (159)
T TIGR02890        71 LREIEHALQKIENGTYGIC   89 (159)
T ss_pred             HHHHHHHHHHHhCCCCCee
Confidence            334444455555 999998


No 118
>cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa. The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly.  The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes. The alpha/beta-tubulin heterodimer is the structural subunit of microtubules.  The alpha- and beta-tubulins share 40% amino-acid sequence identity, exist in several isotype forms, and undergo a variety of posttranslational modifications.  The structures of alpha- and beta-tubulin are basically identical: each monomer is formed by a core of two beta-sheets surrounded by alpha-helices. The monomer structure is very compact, but can be divided into three regions based on function: the amino
Probab=20.16  E-value=1.5e+02  Score=22.27  Aligned_cols=27  Identities=22%  Similarity=0.263  Sum_probs=20.9

Q ss_pred             eeEeeCCCCCCCChhHHHHHHHHhhcc
Q 046457           27 FIVLHGIGDQCSNQGVKQFTENLSSFS   53 (59)
Q Consensus        27 vViwHGlGDsC~n~gm~~~~~ll~~~~   53 (59)
                      +++.|++|.-.-+..-..+.+.|++++
T Consensus       134 f~i~~sl~GGTGSGlgs~l~e~l~d~y  160 (434)
T cd02186         134 FLIFHSFGGGTGSGFGSLLLERLSVDY  160 (434)
T ss_pred             eEEEeccCCCcchhHHHHHHHHHHHhc
Confidence            788999998766654456778888877


Done!