Citrus Sinensis ID: 046470

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------89

MGNLVSTFLPADLFDRTLNCVGEQAKYIWGLEKNLGGLETEFHKLTRTRDDLRTRVEVDEQAPRTRRTNQVVGWLEDVQKLETEFTELQQLRAQEMDRLCLGGLFSRDLVSSYNFGRKVVELTDQVTNLKKDGEELEVLVEITPDGAAIELPVDHTVVGQELLLYRVWKCITDQDKNRGIIGLYGIGGVGKTTLLTQVNNNFCHEQHHFDVVIWAAVSTLQDDIGKRIGFSENWWKKKSPEEKAVDISSILSRKEFVLLLDDIWKPINLKDMGVPLQNLNAGSKIVLTTRSVDVCDQMDAEKVEVSCLAHDEAWKLFQKMVERSTLDSHASIPELAKTLARECGGLPLALKTVGRAMKSRSNIGDWKRAIKKIRTSASKFSGMEEKVFSRLKFSYDSLSDELRSCLLYCCLYPEDYKISKRELIDYWISEGFVDDFDDGWEFINDLLHACLLEEEGDDHVKMHDMIREMSLWVACTIEKEKENYLVRTGFRLTEAPAVEEWEGAKRISLRGNRFDSLSEIPTSPRLITLLLIANSIDEITDGFFQSMSSLRVLSLGSNALSKLPSGISSLVSLHHLDLSWTEITGLPQELKALEKLRYLNLEHAYMLSIIPHQLISGFSKLEVLRLLGCGSNCVTVTEEEGNVLCDDAGLLMKELLGLKHLNFLSWSFRSSLAVQKFFKYPKLVSITQSVVVYQCECPLFNVLHLAYMENLQELHLEDSDLEEMRIDGPEEVKKLFQSGFRSLSIVSVENCEKMKDLTWLVFVQNLKELEISRCHAVEDIISVDKLRDISEIIGSEHNFFAQLEALNIFNNVNLKSIYPNPLPFPKLKKIQIYSCPELKKLPLNSSSAKERRVVIEGTKKWWEELQWEDQAAQNAFSLDVVLPEYLDY

cccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHcccccccccccEEEEEEEcccHHHHHHHHcccccccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEEccHHHHHHccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccEEEccHHHHHHHHHHHHHHHcccccEEEccccccccccccccccEEEEEECcccccccccccccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHccccccccccccccccccccHHHHccccccccccccccccccccHHHHcccccccEEcccccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccccccccccEEECcccccccccccccccccEEEEECccccccccccccccccccEEEEEcccccEEEccccccccccccccccccccccccEEEccccccccECcccccccccccEEEECccccccccccccccccccEEEEEccHHHHcccccccHHHHHHccccccccccccc

MGNLVSTFLPADLFDRTLNCVGEQAKYIWGLEKNLGGLETEFHKLTRTRDDLRTRVEVDEQAPRTRRTNQVVGWLEDVQKLETEFTELQQLRAQEMDRLCLGGLFSRDLVSSYNFGRKVVELTDQVTNLKKDGEELEVLVEIT****AIELPVDHTVVGQELLLYRVWKCITDQDKNRGIIGLYGIGGVGKTTLLTQVNNNFCHEQHHFDVVIWAAVSTLQDDIGKRIGFSENWWK********VDISSILSRKEFVLLLDDIWKPINLKDMGVPLQNLNAGSKIVLTTRSVDVCDQMDAEKVEVSCLAHDEAWKLFQKMVERSTLDSHASIPELAKTLARECGGLPLALKTVGRAMKSRSNIGDWKRAIKKIRT****F*GMEEKVFSRLKFSYDSLSDELRSCLLYCCLYPEDYKISKRELIDYWISEGFVDDFDDGWEFINDLLHACLLEEEGDDHVKMHDMIREMSLWVACTIEKEKENYLVRTGFRLTEAPAVEEWEGAKRISLRGNRFDSLSEIPTSPRLITLLLIANSIDEITDGFFQSMSSLRVLSLGSNALSKLPSGISSLVSLHHLDLSWTEITGLPQELKALEKLRYLNLEHAYMLSIIPHQLISGFSKLEVLRLLGCGSNCVTVTEEEGNVLCDDAGLLMKELLGLKHLNFLSWSFRSSLAVQKFFKYPKLVSITQSVVVYQCECPLFNVLHLAYMENLQELHLEDSDLEEMRIDGPEEVKKLFQSGFRSLSIVSVENCEKMKDLTWLVFVQNLKELEISRCHAVEDIISVDKLRDISEIIGSEHNFFAQLEALNIFNNVNLKSIYPNPLPFPKLKKIQIYSCPELKKLPLN********VVIEGTKKWWEELQWEDQAAQNAFSLDVVLPEYLDY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGNLVSTFLPADLFDRTLNCVGEQAKYIWGLEKNLGGLETEFHKLTRTRDDLRTRVEVDEQAPRTRRTNQVVGWLEDxxxxxxxxxxxxxxxxxxxxxLCLGGLFSRDLVSSYNFGRKxxxxxxxxxxxxxxxxxxxxxVEITPDGAAIELPVDHTVVGQELLLYRVWKCITDQDKNRGIIGLYGIGGVGKTTLLTQVNNNFCHEQHHFDVVIWAAVSTLQDDIGKRIGFSENWWKKKSPEEKAVDISSILSRKEFVLLLDDIWKPINLKDMGVPLQNLNAGSKIVLTTRSVDVCDQMDAEKVEVSCLAHDEAWKLFQKMVERSTLDSHASIPELAKTLARECGGLPLALKTVGRAMKSRSNIGDWKRAIKKIRTSASKFSGMEEKVFSRLKFSYDSLSDELRSCLLYCCLYPEDYKISKRELIDYWISEGFVDDFDDGWEFINDLLHACLLEEEGDDHVKMHDMIREMSLWVACTIEKEKENYLVRTGFRLTEAPAVEEWEGAKRISLRGNRFDSLSEIPTSPRLITLLLIANSIDEITDGFFQSMSSLRVLSLGSNALSKLPSGISSLVSLHHLDLSWTEITGLPQELKALEKLRYLNLEHAYMLSIIPHQLISGFSKLEVLRLLGCGSNCVTVTEEEGNVLCDDAGLLMKELLGLKHLNFLSWSFRSSLAVQKFFKYPKLVSITQSVVVYQCECPLFNVLHLAYMENLQELHLEDSDLEEMRIDGPEEVKKLFQSGFRSLSIVSVENCEKMKDLTWLVFVQNLKELEISRCHAVEDIISVDKLRDISEIIGSEHNFFAQLEALNIFNNVNLKSIYPNPLPFPKLKKIQIYSCPELKKLPLNSSSAKERRVVIEGTKKWWEELQWEDQAAQNAFSLDVVLPEYLDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Disease resistance protein RPS5	Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae. Also confers resistance against Hyaloperonospora parasitica (downy mildew). Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Requires PBS1 to trigger the defense reaction against avrPphB. Probably triggers the defense mechanism when PBS1 is cleaved by avrPphB, suggesting that it detects indirectly the protease activity of avrPphB, and possibly binds to the cleaved RPS5.	probable	O64973

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 489-632
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 498-781,795-855
View the alignment between query and template
View the model in PyMOL

Template: 3A79, chain B
Confidence level:very confident
Coverage over the Query: 504-634,651-857
View the alignment between query and template
View the model in PyMOL

Template: 1Z6T, chain A
Confidence level:very confident
Coverage over the Query: 155-474
View the alignment between query and template
View the model in PyMOL

Template: 3QFL, chain A
Confidence level:confident
Coverage over the Query: 10-97
View the alignment between query and template
View the model in PyMOL