BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046486
         (202 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QKM|B Chain B, The Crystal Structure Of Fission Yeast Mrna Decapping
           Enzyme Dcp1-Dcp2 Complex
 pdb|2QKM|D Chain D, The Crystal Structure Of Fission Yeast Mrna Decapping
           Enzyme Dcp1-Dcp2 Complex
 pdb|2QKM|F Chain F, The Crystal Structure Of Fission Yeast Mrna Decapping
           Enzyme Dcp1-Dcp2 Complex
 pdb|2QKM|H Chain H, The Crystal Structure Of Fission Yeast Mrna Decapping
           Enzyme Dcp1-Dcp2 Complex
          Length = 266

 Score = 26.9 bits (58), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 7/48 (14%)

Query: 123 QCSEGKGWGPCHQLGFGQGR------HCDWCYARLVYESWGGSCHSRV 164
           QC   KGW      GF +G+        D C  R VYE  G  C SR+
Sbjct: 110 QCVLVKGWKASSGWGFPKGKIDKDESDVD-CAIREVYEETGFDCSSRI 156


>pdb|2A6T|A Chain A, Crystal Structure Of S.Pombe Mrna Decapping Enzyme Dcp2p
 pdb|2A6T|B Chain B, Crystal Structure Of S.Pombe Mrna Decapping Enzyme Dcp2p
          Length = 271

 Score = 26.6 bits (57), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 7/48 (14%)

Query: 123 QCSEGKGWGPCHQLGFGQGR------HCDWCYARLVYESWGGSCHSRV 164
           QC   KGW      GF +G+        D C  R VYE  G  C SR+
Sbjct: 115 QCVLVKGWKASSGWGFPKGKIDKDESDVD-CAIREVYEETGFDCSSRI 161


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.139    0.487 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,924,376
Number of Sequences: 62578
Number of extensions: 170671
Number of successful extensions: 364
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 359
Number of HSP's gapped (non-prelim): 10
length of query: 202
length of database: 14,973,337
effective HSP length: 94
effective length of query: 108
effective length of database: 9,091,005
effective search space: 981828540
effective search space used: 981828540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)