Citrus Sinensis ID: 046490

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKYI
cccHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccccccccccccEEccEEcccccEEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccEEEEEEEcc
ccHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEcHccHHccHHHHHHHHHHHHcccccccccccccccEEEccEEcccccEEEEEEEEEcccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHcccccccccEEEccccEEEEEcccc
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLignkgfvdeddlqklPYIKAILKETfrlnplgpiiprettkscmidgyeipaktlvylngwaisrdpevwerpdefdpdrfisgdnrrfcpgihMGIATLELAIANLLYkfdwempagikiqdldfditpgivmhkknpfclvatkyi
mkvfrcvqnvfvgatdtsaatmTWAMTNVMKNPRVMEKAQKEVKDLIgnkgfvdeddlqKLPYIKAILketfrlnplgpiiprettkscMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIvmhkknpfclvatkyi
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKYI
**VFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVM****KEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATK**
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKYI
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKYI
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKY*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.974 0.376 0.458 2e-52
O65782499 Cytochrome P450 83B1 OS=A yes no 0.969 0.376 0.458 8e-51
Q9LIP3500 Cytochrome P450 71B37 OS= no no 0.974 0.378 0.439 8e-50
O81970499 Cytochrome P450 71A9 OS=G no no 0.953 0.370 0.457 7e-49
P58051496 Cytochrome P450 71B14 OS= no no 0.932 0.364 0.451 8e-49
Q9LIP4500 Cytochrome P450 71B36 OS= no no 0.969 0.376 0.426 5e-48
Q9LIP6500 Cytochrome P450 71B34 OS= no no 0.969 0.376 0.441 7e-48
Q9XHE8496 Cytochrome P450 71D18 OS= N/A no 0.953 0.372 0.43 8e-48
Q6WKZ1496 Cytochrome P450 71D18 OS= N/A no 0.953 0.372 0.43 8e-48
Q9ZU07496 Cytochrome P450 71B12 OS= no no 0.943 0.368 0.447 1e-47
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function desciption
 Score =  204 bits (520), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 94/205 (45%), Positives = 139/205 (67%), Gaps = 16/205 (7%)

Query: 6   CVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIK 65
            + ++F G TDT+A T+ WAM  ++K+P VMEKAQ+EV+ ++G K  V+E+DL +L Y+K
Sbjct: 297 VILDMFSGGTDTTAVTLEWAMAELIKHPDVMEKAQQEVRRVVGKKAKVEEEDLHQLHYLK 356

Query: 66  AILKETFRLNPLGP-IIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDP 124
            I+KET RL+P+ P ++PRE+T+  +I GY IPAKT V++N WAI RDP+ WE  +EF P
Sbjct: 357 LIIKETLRLHPVAPLLVPRESTRDVVIRGYHIPAKTRVFINAWAIGRDPKSWENAEEFLP 416

Query: 125 DRFIS---------------GDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQD 169
           +RF++               G  RR CPGI  GI+++E+++ANLLY F+WE+P  +  +D
Sbjct: 417 ERFVNNSVDFKGQDFQLIPFGAGRRGCPGIAFGISSVEISLANLLYWFNWELPGDLTKED 476

Query: 170 LDFDITPGIVMHKKNPFCLVATKYI 194
           LD     GI +H K P  LVA +++
Sbjct: 477 LDMSEAVGITVHMKFPLQLVAKRHL 501
Involved in the metabolism of compounds associated with the development of flavor in the ripening fruit process, possibly by acting as trans-cinnamic acid 4-hydrolase.
Persea americana (taxid: 3435)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function description
>sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 Back     alignment and function description
>sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
302142620 912 unnamed protein product [Vitis vinifera] 0.963 0.205 0.591 5e-68
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.953 0.373 0.597 7e-68
225458053 498 PREDICTED: cytochrome P450 83B1 [Vitis v 0.969 0.377 0.588 7e-68
225458049 496 PREDICTED: cytochrome P450 83B1 [Vitis v 0.969 0.379 0.573 7e-67
225458059 496 PREDICTED: cytochrome P450 83B1-like [Vi 0.958 0.375 0.574 8e-65
255538870 497 cytochrome P450, putative [Ricinus commu 0.969 0.378 0.588 9e-65
255589898267 cytochrome P450, putative [Ricinus commu 0.969 0.704 0.573 8e-64
224065988 504 cytochrome P450 [Populus trichocarpa] gi 0.963 0.371 0.578 1e-63
224062041 513 cytochrome P450 [Populus trichocarpa] gi 0.938 0.354 0.567 1e-62
255542144 441 cytochrome P450, putative [Ricinus commu 0.979 0.430 0.565 2e-62
>gi|302142620|emb|CBI19823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 150/203 (73%), Gaps = 16/203 (7%)

Query: 7   VQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKA 66
           + N+FVG TDT AAT+ WAMT +MKNPRVM+KAQ+EV++  G KGF+ EDD++KLPY+KA
Sbjct: 709 LMNIFVGGTDTGAATVIWAMTALMKNPRVMKKAQEEVRNTFGKKGFIGEDDVEKLPYLKA 768

Query: 67  ILKETFRLNPLGP-IIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPD 125
           ++KET RL P  P +IPRET + C IDGYEIP KTLV++N WAI RDPE WE P+EF P+
Sbjct: 769 VVKETMRLLPAVPLLIPRETLQKCSIDGYEIPPKTLVFVNAWAIGRDPEAWENPEEFIPE 828

Query: 126 RFIS---------------GDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDL 170
           RF+                G  RR CPGIH+G  T+EL +ANLLY FDWEMPAG+  +D+
Sbjct: 829 RFLGSSVDFRGQNYKLIPFGAGRRVCPGIHIGAVTVELTLANLLYSFDWEMPAGMNKEDI 888

Query: 171 DFDITPGIVMHKKNPFCLVATKY 193
           DFD+ PG+ MHKKN  CL+A KY
Sbjct: 889 DFDVIPGLTMHKKNALCLMAKKY 911

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458053|ref|XP_002280472.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] gi|147832399|emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458049|ref|XP_002280438.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458059|ref|XP_002278372.1| PREDICTED: cytochrome P450 83B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255538870|ref|XP_002510500.1| cytochrome P450, putative [Ricinus communis] gi|223551201|gb|EEF52687.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255589898|ref|XP_002535120.1| cytochrome P450, putative [Ricinus communis] gi|223523988|gb|EEF27263.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224065988|ref|XP_002301993.1| cytochrome P450 [Populus trichocarpa] gi|222843719|gb|EEE81266.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224062041|ref|XP_002300725.1| cytochrome P450 [Populus trichocarpa] gi|222842451|gb|EEE79998.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542144|ref|XP_002512136.1| cytochrome P450, putative [Ricinus communis] gi|223549316|gb|EEF50805.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2125264499 CYP83B1 ""cytochrome P450, fam 0.634 0.246 0.488 4.8e-50
TAIR|locus:2079316500 CYP71B37 ""cytochrome P450, fa 0.969 0.376 0.441 2.3e-46
TAIR|locus:2065254500 CYP71B9 ""cytochrome P450, fam 0.969 0.376 0.441 6.2e-46
TAIR|locus:2146980496 CYP71B14 ""cytochrome P450, fa 0.932 0.364 0.451 1.6e-45
TAIR|locus:2079251500 CYP71B34 ""cytochrome P450, fa 0.969 0.376 0.441 4.4e-45
TAIR|locus:2079311500 CYP71B36 ""cytochrome P450, fa 0.969 0.376 0.426 7.1e-45
TAIR|locus:2093561500 CYP71B26 ""cytochrome P450, fa 0.969 0.376 0.436 9.1e-45
TAIR|locus:2179280496 CYP71B12 ""cytochrome P450, fa 0.932 0.364 0.451 3.1e-44
TAIR|locus:2179290496 CYP71B13 ""cytochrome P450, fa 0.932 0.364 0.441 3.1e-44
UNIPROTKB|Q9XHE8496 CYP71D18 "Cytochrome P450 71D1 0.953 0.372 0.435 5e-44
TAIR|locus:2125264 CYP83B1 ""cytochrome P450, family 83, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 340 (124.7 bits), Expect = 4.8e-50, Sum P(2) = 4.8e-50
 Identities = 61/125 (48%), Positives = 91/125 (72%)

Query:     7 VQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKA 66
             + ++ V  TDT+AA + WAMT ++K P  M+KAQ EV+ +IG+KG+V E+D+  LPY+KA
Sbjct:   293 ILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRSVIGDKGYVSEEDIPNLPYLKA 352

Query:    67 ILKETFRLNPLGPII-PRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVW-ERPDEFDP 124
             ++KE+ RL P+ PI+  RET     I GY+IPAKT++ +N WA+SRD   W + P+EF P
Sbjct:   353 VIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIP 412

Query:   125 DRFIS 129
             +RF++
Sbjct:   413 ERFMN 417
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA;IMP
GO:0009759 "indole glucosinolate biosynthetic process" evidence=IDA
GO:0000162 "tryptophan biosynthetic process" evidence=IMP
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0048830 "adventitious root development" evidence=TAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0009682 "induced systemic resistance" evidence=IEP
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006520 "cellular amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
GO:0009641 "shade avoidance" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065254 CYP71B9 ""cytochrome P450, family 71, subfamily B, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146980 CYP71B14 ""cytochrome P450, family 71, subfamily B, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093561 CYP71B26 ""cytochrome P450, family 71, subfamily B, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179280 CYP71B12 ""cytochrome P450, family 71, subfamily B, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XHE8 CYP71D18 "Cytochrome P450 71D18" [Mentha spicata (taxid:29719)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 6e-63
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 8e-54
pfam00067461 pfam00067, p450, Cytochrome P450 2e-53
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-51
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 2e-51
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-50
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-49
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-32
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-30
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-30
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-29
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-27
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 2e-25
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-23
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-20
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 3e-18
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 6e-14
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-13
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 2e-13
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 7e-12
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 8e-12
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 1e-11
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 8e-10
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 9e-07
PLN02648480 PLN02648, PLN02648, allene oxide synthase 9e-06
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-04
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score =  202 bits (514), Expect = 6e-63
 Identities = 95/207 (45%), Positives = 135/207 (65%), Gaps = 19/207 (9%)

Query: 7   VQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKA 66
           + ++ V  TDT+AA + WAMT ++K P  M+KAQ EV+++IG+KG+V E+D+  LPY+KA
Sbjct: 293 ILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVIGDKGYVSEEDIPNLPYLKA 352

Query: 67  ILKETFRLNPLGPI-IPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVW-ERPDEFDP 124
           ++KE+ RL P+ PI + RET     I GY+IPAKT++ +N WA+SRD   W + P+EF P
Sbjct: 353 VIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIP 412

Query: 125 DRFIS-----------------GDNRRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKI 167
           +RF+                  G  RR CP +H+GIA +E+  ANLLYKFDW +P GIK 
Sbjct: 413 ERFMKEHKGVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKP 472

Query: 168 QDLDFDITPGIVMHKKNPFCLVATKYI 194
           +D+  D+  G+ MHKK    L  TK+I
Sbjct: 473 EDIKMDVMTGLAMHKKEHLVLAPTKHI 499

Length = 499
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02966502 cytochrome P450 83A1 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-51  Score=346.70  Aligned_cols=191  Identities=30%  Similarity=0.516  Sum_probs=177.3

Q ss_pred             ChhHHHHHHHHhhchhHHHHHHHHHHHHHHhCHHHHHHHHHHHHHhhcCCCCCCHhhhcCCHHHHHHHHHhccCCCCCCC
Q 046490            1 MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPI   80 (194)
Q Consensus         1 e~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~E~~~~~~~~~~~~~~~~~~l~~l~~~i~E~lRl~~~~~~   80 (194)
                      |||+++++.+++||+|||+++|++++|+||+||++|+||++||+++......++++.+++|+||++||+||||+||+++.
T Consensus       293 dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~  372 (499)
T KOG0158|consen  293 DEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPAPF  372 (499)
T ss_pred             HHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCccc
Confidence            68999999999999999999999999999999999999999999997776669999999999999999999999999999


Q ss_pred             CccccCCCceec-CeeeCCCCEEeechhhhccCCCCCCCCCCCCCCCCCC--------------CCCCCccccHHHHHHH
Q 046490           81 IPRETTKSCMID-GYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFIS--------------GDNRRFCPGIHMGIAT  145 (194)
Q Consensus        81 ~~R~~~~~~~i~-g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~~~--------------g~G~r~C~G~~~a~~~  145 (194)
                      ..|.|++|++++ ++.|+||+.|.++.+++||||++||||++|+||||.+              |.|||+|+|++||++|
T Consensus       373 ~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq  452 (499)
T KOG0158|consen  373 LNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFALME  452 (499)
T ss_pred             ccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHHHHH
Confidence            999999999999 9999999999999999999999999999999999985              9999999999999999


Q ss_pred             HHHHHHHHHhcceeecCCCCCCCCCCCCC-cCceeeecCCCeEEEEeecC
Q 046490          146 LELAIANLLYKFDWEMPAGIKIQDLDFDI-TPGIVMHKKNPFCLVATKYI  194 (194)
Q Consensus       146 ~~~~l~~ll~~f~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~v~~~~r~  194 (194)
                      +|++|++||++|+++..+..  .+. ... ..+.++.|++++++++++|.
T Consensus       453 ~K~~L~~lL~~f~~~~~~~t--~~~-~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  453 AKLALAHLLRNFSFEVCPTT--IIP-LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHHHHHHHhhCEEecCCcc--cCc-ccCCccceeeecCCceEEEEEeCC
Confidence            99999999999999988733  222 222 23778999999999999985

>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-25
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 3e-22
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 6e-20
3pm0_A507 Structural Characterization Of The Complex Between 7e-18
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 7e-17
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 8e-17
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 9e-17
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-16
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-16
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-16
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-16
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-16
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-16
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 5e-16
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-15
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-15
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-15
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-15
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-15
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-15
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-15
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 9e-15
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-14
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-14
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 7e-13
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 1e-12
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 1e-12
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-12
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-12
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-12
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 4e-12
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 7e-12
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 9e-12
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 8e-11
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 9e-11
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-10
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-10
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-10
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 2e-09
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 2e-09
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 2e-09
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 3e-09
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 3e-09
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 4e-09
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 8e-09
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-08
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 6e-08
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-07
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 3e-07
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-07
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-07
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 3e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 3e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-07
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-07
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 3e-07
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-07
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-07
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-07
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 3e-07
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 4e-07
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 4e-07
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 4e-07
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 4e-07
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 4e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 5e-07
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 5e-07
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 5e-07
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 6e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 6e-07
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 6e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 6e-07
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 6e-07
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 6e-07
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 7e-07
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 7e-07
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 7e-07
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 8e-07
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 8e-07
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 8e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-06
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-06
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-06
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 2e-06
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 2e-06
3b98_A475 Crystal Structure Of Zebrafish Prostacyclin Synthas 2e-06
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 4e-06
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 5e-06
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-05
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 7e-05
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 7e-05
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 7e-05
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 7e-05
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 7e-05
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 1e-04
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 2e-04
3dam_A473 Crystal Structure Of Allene Oxide Synthase Length = 3e-04
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 5e-04
2rcm_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 6e-04
2rch_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 6e-04
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 7e-04
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 104/204 (50%), Gaps = 23/204 (11%)
Query: 2   KVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKL 61
           K+   V ++F    DT    ++W++  ++  P +  K QKE+  +IG +      D  +L
Sbjct: 282 KIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLSDRPQL 341
Query: 62  PYIKAILKETFRLNPLGPI-IPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPD 120
           PY++A + ETFR +   P  IP  TT+   ++G+ IP K  V++N W ++ DPE+WE P 
Sbjct: 342 PYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPS 401
Query: 121 EFDPDRFISGD-----------------NRRFCPGIHMGIATLELAIANLLYKFDWEMPA 163
           EF P+RF++ D                  +R C G  +    + L +A LL + ++ +P 
Sbjct: 402 EFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPP 461
Query: 164 GIKIQDLDFDITPGIVMHKKNPFC 187
           G+K+     D+TP   +  K+  C
Sbjct: 462 GVKV-----DLTPIYGLTMKHARC 480
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3B98|A Chain A, Crystal Structure Of Zebrafish Prostacyclin Synthase (Cytochrome P450 8a1) Length = 475 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase Length = 473 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 74a) At 1.73 A Resolution Length = 495 Back     alignment and structure
>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 13(S)-Hod At 1.85 A Resolution Length = 495 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-75
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-70
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 8e-68
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-62
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-50
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-50
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-49
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-44
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-44
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-44
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-43
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-42
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-42
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 9e-41
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-40
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-39
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-39
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-39
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-38
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-38
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-38
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 6e-38
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-38
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-37
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-37
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 4e-34
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-32
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-32
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 9e-29
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-11
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 2e-10
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 2e-10
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 4e-10
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 5e-10
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 8e-10
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 2e-09
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 3e-09
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 3e-09
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 3e-09
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 9e-09
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 1e-08
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-08
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-08
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 2e-08
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 2e-08
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 5e-08
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 5e-08
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 6e-08
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 6e-08
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 6e-08
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 7e-08
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 7e-08
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 7e-08
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 8e-08
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 9e-08
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 9e-08
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 9e-08
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 1e-07
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-07
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-07
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-07
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 2e-07
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-07
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-07
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 3e-07
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 3e-07
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 5e-07
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 7e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 8e-07
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 1e-06
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 7e-06
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 9e-06
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 1e-05
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 8e-05
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  233 bits (597), Expect = 2e-75
 Identities = 49/199 (24%), Positives = 86/199 (43%), Gaps = 18/199 (9%)

Query: 7   VQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKA 66
           V  +  G  DT++ T+ W +  + +N +V +  + EV              LQ +P +KA
Sbjct: 280 VTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKA 339

Query: 67  ILKETFRLNPLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDR 126
            +KET RL+P+   + R      ++  Y IPAKTLV +  +A+ R+P  +  P+ FDP R
Sbjct: 340 SIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTR 399

Query: 127 FISGDN-------------RRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFD 173
           ++S D               R C G  +    + + + N+L  F  E+     +      
Sbjct: 400 WLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDV-----G 454

Query: 174 ITPGIVMHKKNPFCLVATK 192
            T  +++  + P       
Sbjct: 455 TTFNLILMPEKPISFTFWP 473
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-51  Score=343.66  Aligned_cols=191  Identities=25%  Similarity=0.477  Sum_probs=173.6

Q ss_pred             ChhHHHHHHHHhhchhHHHHHHHHHHHHHHhCHHHHHHHHHHHHHhhcCCCCCCHhhhcCCHHHHHHHHHhccCCCCCCC
Q 046490            1 MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPI   80 (194)
Q Consensus         1 e~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~E~~~~~~~~~~~~~~~~~~l~~l~~~i~E~lRl~~~~~~   80 (194)
                      +++.+++.++++||+|||+.+++|++++|++||++|+||++|++.+++....++.+++++|||+++||+|++|++|+++.
T Consensus       271 ~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~  350 (479)
T 3tbg_A          271 ENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPL  350 (479)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTT
T ss_pred             HHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccc
Confidence            36888999999999999999999999999999999999999999999988899999999999999999999999999995


Q ss_pred             -CccccCCCceecCeeeCCCCEEeechhhhccCCCCCCCCCCCCCCCCCC--------------CCCCCccccHHHHHHH
Q 046490           81 -IPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFIS--------------GDNRRFCPGIHMGIAT  145 (194)
Q Consensus        81 -~~R~~~~~~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~~~--------------g~G~r~C~G~~~a~~~  145 (194)
                       ..|.+.+|++++||.||+|+.|.++.+++|+||++|+||++|+||||++              |.|+|.|+|++||++|
T Consensus       351 ~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e  430 (479)
T 3tbg_A          351 GVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARME  430 (479)
T ss_dssp             CCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHH
T ss_pred             cceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCCCCceecCCCCCcCChhHHHHHHH
Confidence             5556788999999999999999999999999999999999999999985              9999999999999999


Q ss_pred             HHHHHHHHHhcceeecCCCCCCCCCCCCCcCceeeecCCCeEEEEeecC
Q 046490          146 LELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKYI  194 (194)
Q Consensus       146 ~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r~  194 (194)
                      ++++++.|+++|+|+++++.  .........+++..|+ +++|+++||+
T Consensus       431 ~~~~la~ll~~f~~~~~~~~--~~~~~~~~~~~~~~P~-~~~v~~~pRs  476 (479)
T 3tbg_A          431 LFLFFTSLLQHFSFSVPTGQ--PRPSHHGVFAFLVSPS-PYELCAVPRH  476 (479)
T ss_dssp             HHHHHHHHHHHEEEECCTTS--CCCCSCEEESSSEEEC-CCCBEEEEC-
T ss_pred             HHHHHHHHHHccEEEeCCCC--CCccccccceeeecCC-CeEEEEEECC
Confidence            99999999999999998765  2233344445666775 8999999995
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-35
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-31
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 8e-30
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 7e-21
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-20
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-16
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-14
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-14
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 3e-14
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-13
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 3e-12
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 8e-12
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 4e-11
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-11
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 6e-11
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 9e-11
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 3e-10
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-09
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-08
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-08
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-08
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  127 bits (319), Expect = 2e-35
 Identities = 43/191 (22%), Positives = 89/191 (46%), Gaps = 17/191 (8%)

Query: 16  DTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLN 75
           +T+++ +++ M  +  +P V +K Q+E+  ++ NK     D + ++ Y+  ++ ET RL 
Sbjct: 281 ETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLF 340

Query: 76  PLGPIIPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFISGDN--- 132
           P+   + R   K   I+G  IP   +V +  +A+ RDP+ W  P++F P+RF   +    
Sbjct: 341 PIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNI 400

Query: 133 -----------RRFCPGIHMGIATLELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMH 181
                       R C G+   +  ++LA+  +L  F ++         +   ++ G ++ 
Sbjct: 401 DPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE---TQIPLKLSLGGLLQ 457

Query: 182 KKNPFCLVATK 192
            + P  L    
Sbjct: 458 PEKPVVLKVES 468
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.97
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-48  Score=325.39  Aligned_cols=190  Identities=23%  Similarity=0.488  Sum_probs=178.1

Q ss_pred             ChhHHHHHHHHhhchhHHHHHHHHHHHHHHhCHHHHHHHHHHHHHhhcCCCCCCHhhhcCCHHHHHHHHHhccCCCCCCC
Q 046490            1 MKVFRCVQNVFVGATDTSAATMTWAMTNVMKNPRVMEKAQKEVKDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPLGPI   80 (194)
Q Consensus         1 e~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~E~~~~~~~~~~~~~~~~~~l~~l~~~i~E~lRl~~~~~~   80 (194)
                      |++..+++.+++||++||+.+++|++++|++||++|+++++|++.+++.....+.+.+.++|||++||+|++|++|+.+.
T Consensus       266 ~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~~~l~a~i~E~lRl~p~~~~  345 (472)
T d1tqna_         266 LELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMR  345 (472)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHCHHHHHHHHHHHHHCCTTCC
T ss_pred             hHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHHhhccccccceeeeccccCCcccc
Confidence            47889999999999999999999999999999999999999999999988888999999999999999999999999999


Q ss_pred             CccccCCCceecCeeeCCCCEEeechhhhccCCCCCCCCCCCCCCCCCC--------------CCCCCccccHHHHHHHH
Q 046490           81 IPRETTKSCMIDGYEIPAKTLVYLNGWAISRDPEVWERPDEFDPDRFIS--------------GDNRRFCPGIHMGIATL  146 (194)
Q Consensus        81 ~~R~~~~~~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~~~--------------g~G~r~C~G~~~a~~~~  146 (194)
                      +.|.+.+|+.++||.||||+.|+++.+++|+||++|+||++|+||||++              |.|+|.|+|+++|.+++
T Consensus       346 ~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~  425 (472)
T d1tqna_         346 LERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNM  425 (472)
T ss_dssp             EEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHHHH
T ss_pred             cccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCccChhHHHHHHHH
Confidence            8999999999999999999999999999999999999999999999985              89999999999999999


Q ss_pred             HHHHHHHHhcceeecCCCCCCCCCCCCCcCceeeecCCCeEEEEeec
Q 046490          147 ELAIANLLYKFDWEMPAGIKIQDLDFDITPGIVMHKKNPFCLVATKY  193 (194)
Q Consensus       147 ~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r  193 (194)
                      +++++.|+++|||+++++.   ..+.....+.++.|+.++.|++++|
T Consensus       426 ~~~la~ll~~f~~~~~~~~---~~~~~~~~~~~~~p~~~~~~~~~~R  469 (472)
T d1tqna_         426 KLALIRVLQNFSFKPCKET---QIPLKLSLGGLLQPEKPVVLKVESR  469 (472)
T ss_dssp             HHHHHHHHTTEEEECCTTC---CSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred             HHHHHHHHHhCEEEeCCCC---CCCceeccceEEeeCCCEEEEEEEC
Confidence            9999999999999987754   3345555667788889999999998
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure