BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046521
         (202 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HWC|A Chain A, Crystal Structure Of Chlorophenol 4-Monooxygenase (Tftd)
           Of Burkholderia Cepacia Ac1100
 pdb|3HWC|B Chain B, Crystal Structure Of Chlorophenol 4-Monooxygenase (Tftd)
           Of Burkholderia Cepacia Ac1100
 pdb|3HWC|C Chain C, Crystal Structure Of Chlorophenol 4-Monooxygenase (Tftd)
           Of Burkholderia Cepacia Ac1100
 pdb|3HWC|D Chain D, Crystal Structure Of Chlorophenol 4-Monooxygenase (Tftd)
           Of Burkholderia Cepacia Ac1100
          Length = 515

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 19/41 (46%)

Query: 113 CTSLFANVNCLLTKFYDISCGENLKLYILAFCAWKHYRLCI 153
            T++F NV     + + I   E+ KLY      W HY + I
Sbjct: 254 STTVFDNVFIPWEQVFHIGNPEHAKLYPQRIFDWVHYHILI 294


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.332    0.146    0.486 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,783,366
Number of Sequences: 62578
Number of extensions: 214799
Number of successful extensions: 999
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 997
Number of HSP's gapped (non-prelim): 3
length of query: 202
length of database: 14,973,337
effective HSP length: 94
effective length of query: 108
effective length of database: 9,091,005
effective search space: 981828540
effective search space used: 981828540
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 49 (23.5 bits)