Citrus Sinensis ID: 046522


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MGSAPAQIPTSFGHELRACLRCRLVKTYDQFRESGCENCPFFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR
ccccccccccccccccEEccccEEEEEHHHHHHcccccccccccccccccccccccccccEEEEEEcccccHHHHHHHccccccEEEEEEccccccHHHHHHHHHcccccccccc
***********FGHELRACLRCRLVKTYDQFRESGCENCPFFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSAPAQIPTSFGHELRACLRCRLVKTYDQFRESGCENCPFFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription elongation factor SPT4 homolog 2 May regulate transcription elongation by RNA polymerase II. May enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex.confidentQ94C60
Transcription elongation factor SPT4 homolog 1 May regulate transcription elongation by RNA polymerase II. May enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex.probableQ8LCQ3
Transcription elongation factor SPT4 May function as a component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates transcription elongation by RNA polymerase II. DSIF may enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex.probableQ9TZ93

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H7H, chain A
Confidence level:very confident
Coverage over the Query: 6-115
View the alignment between query and template
View the model in PyMOL