Citrus Sinensis ID: 046528

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MQNLQLETKKLFASVSMGEEKPFDFFRILFEGVIAGGTAGVVVETALYPIDTIKTRLQGLYSGLAGNLAGVLPASALFVGVYEPTKQKLLQIFPENLSAAAHLTAGAIGGFAASLVRVPTEVVKQRLQTGQYASAPDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRISYKAAARRDLNDPENAIIGAFAGAITGAITTPLDVIKTRLMVQGSANQYKGIFDCVQTIVREEGPPALLKGIGPRVMWIGIGGSIFFGVLERTKRMLAQRRPVHDQNSKED
ccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHEEccHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
*******************EKPFDFFRILFEGVIAGGTAGVVVETALYPIDTIKTRLQGLYSGLAGNLAGVLPASALFVGVYEPTKQKLLQIFPENLSAAAHLTAGAIGGFAASLVRVPTEVVKQRLQTGQYASAPDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRISYKAAARRDLNDPENAIIGAFAGAITGAITTPLDVIKTRLMVQGSANQYKGIFDCVQTIVREEGPPALLKGIGPRVMWIGIGGSIFFGVLERTKRM***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNLQLETKKLFASVSMGEEKPFDFFRILFEGVIAGGTAGVVVETALYPIDTIKTRLQGLYSGLAGNLAGVLPASALFVGVYEPTKQKLLQIFPENLSAAAHLTAGAIGGFAASLVRVPTEVVKQRLQTGQYASAPDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRISYKAAARRDLNDPENAIIGAFAGAITGAITTPLDVIKTRLMVQGSANQYKGIFDCVQTIVREEGPPALLKGIGPRVMWIGIGGSIFFGVLERTKRMLAQRRPVHDQNSKED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
S-adenosylmethionine mitochondrial carrier protein Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.probableQ6GLA2
S-adenosylmethionine mitochondrial carrier protein Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.probableQ5U680
S-adenosylmethionine mitochondrial carrier protein homolog Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May mediate the transport of S-adenosylmethionine (SAM) into the mitochondria.probableQ9VBN7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 27-271
View the alignment between query and template
View the model in PyMOL