BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046540
(93 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OD5|A Chain A, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer
pdb|1OD5|B Chain B, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer
Length = 492
Score = 27.3 bits (59), Expect = 2.5, Method: Composition-based stats.
Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
Query: 27 NDCLNNNMKLGYDLATRLEASGGLTECWNVLMEPPKSCSNEIV 69
N+C NN+ + R+E+ GGL E WN P C+ V
Sbjct: 6 NECQLNNLN-ALEPDHRVESEGGLIETWNS-QHPELQCAGVTV 46
>pdb|2D5F|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5F|B Chain B, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|B Chain B, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|C Chain C, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|D Chain D, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|E Chain E, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|F Chain F, Crystal Structure Of Recombinant Soybean Proglycinin
A3b4 Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
Length = 493
Score = 27.3 bits (59), Expect = 2.5, Method: Composition-based stats.
Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
Query: 27 NDCLNNNMKLGYDLATRLEASGGLTECWNVLMEPPKSCSNEIV 69
N+C NN+ + R+E+ GGL E WN P C+ V
Sbjct: 7 NECQLNNLN-ALEPDHRVESEGGLIETWNS-QHPELQCAGVTV 47
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.136 0.432
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,961,704
Number of Sequences: 62578
Number of extensions: 54214
Number of successful extensions: 148
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 148
Number of HSP's gapped (non-prelim): 2
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)